SecReT4
Protein ID: 152973593
T4SS name [ID]Tra_F [112]
Gene symboltraD
Locus tagKPN_pKPN3p06035
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]166728..169040 [+]
Productconjugal transfer protein TraD
Component typeTraD_F
UniProt IDA6TIJ1
KEGG IDkpn:KPN_pKPN3p06035, kpn:KPN_pKPN4p07158
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.3e-146, Aligned region: 172..561
TraD_N [PF12615], Evalue: 4.2e-32, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 9.6e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 6.2e-09, Aligned region: 400..491
T4SS-DNA_transf [PF02534], Evalue: 1.9e-06, Aligned region: 392..507
Protein Sequence: 770 a.a.     [Download]
>gi|152973593|ref|YP_001338644.1| conjugal transfer protein TraD [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDTPEPGPADTDSHASEQPEPVSPPA
PAVMTVTPAPVKSPPTTKRPAAEPSVRATEPPVLRGTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
 
Nucleotide Sequence: 2313 bp     [Download]
>gi|152973416|ref|NC_009649.1|:166728-169040 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGAGTTTCAATGCCAAAGATATGACGCAGGGCGGTCAGATCGCCAATATGCGCTTTCGCATGTTTGGTC
AGATTGCCAATATTATTTTCTACGTGCTGTTTATTTTATTCTGGGTGCTGTGCGGACTGATGCTGATGTA
CCGGCTCAGCTGGCAAACCTTTGTGAACGGCTGCGTATACTGGTGGTGTACGACGCTGGGTCCGATGCGC
GATATTATTCGTTCCCAGCCGGTATACACCATTCAGTATTACGGCCAGTCGCTGGAATATACCTCAGAAC
AAATCCTGGCCGATAAATATACTATCTGGTGCGGAGAGCAGCTGTGGACTGGTTTCGCCTTTGCTGCCGT
GGTTTCTCTTGTTATCTGTATCGTGACGTTCTTCATCGCCAGCTGGGTGCTGGGCCGCCAGGGGAAACAG
CAGAGTGAGGATGAGAACACCGGCGGGCGCCAGCTTTCCGATAAGCCCAAAGAAGTGGCCCGCCAGATGA
AGCGTGATGGAGTGGCCTCCGATATTAAGATTGGCGACCTGCCTATTCTTAAAAACTCCGAAATTCAGAA
CTTCTGCCTCCACGGTACCGTGGGTTCCGGTAAATCCGAAGTTATACGCCGGCTACTGAACTACGTGCGT
GCCCGGGGCGATATGGCCATCATTTACGATCGCTCCTGTGAGTTCGTCAAAAGCTATTACGACCCGTCAC
TGGATAAAATCCTCAACCCGCTGGACTCGCGCTGTGCAGCCTGGGATTTGTGGAAAGAGTGCCTGACGCT
GCCGGACTTCGACAACATCTCCAACACCCTTATCCCGATGGGTACCAAAGAAGATCCGTTCTGGCAGGGC
TCCGGTCGCACTATCTTTGCCGAAGGCGCGTATCTGATGCGCGAAGACGACGATCGGAGCTACGAGAAGC
TGGTCGATACCATGCTGTCCATTAAGATCGACAAGCTGCGCGCCTATCTGCAGAACACGCCGGCAGCGAA
CCTGGTTGAAGAGAAAATTGAGAAAACCGCCATCTCCATTCGAGCTGTGCTGACCAACTACGTCAAGGCT
ATTCGCTACCTGCAGGGCATTGAGAAGAACGGCGAGCCGTTCACTATCCGGGACTGGATGCGCGGCGTCC
GTGAGGACCGACCCAATGGCTGGCTGTTTATCTCCTCCAATGCTGACACCCATGCCTCCCTGAAGCCGGT
TATCTCGATGTGGCTGTCGATTGCCATCCGCGGCCTCCTGGCGATGGGCGAGAACCGTAACCGGCGTGTG
TGGATCTTCGCTGACGAACTTCCCACGCTGCACAAGCTGCCGGACCTGGTCGAAATCCTCCCGGAGGCGC
GTAAATTTGGTGGTTGTTATGTGTTCGGTATTCAGTCTTATGCCCAGCTGGAAGACATCTATGGCGTTAA
GCCTGCCGCCACGCTCTTTGACGTGATGAACACCCGGGCCTTCTTCCGCTCCCCGAGTAAAGAGATTGCG
GAGTTTGCTGCCGGTGAAATTGGTGAGAAGGAAATCCTCAAGGCCAGCGAGCAGTACTCCTACGGTGCTG
ACCCGGTGCGTGATGGTGTATCGACCGGGAAAGAAAAAGAGCGGGAAACGCTGGTCAGTTACTCCGATAT
TCAGACGCTGCCTGACCTGTCCTGTTACGTCACGCTGCCCGGGCCGTATCCGGCCGTGAAACTGGCCCTC
AAATACAAGCCGCGTCCGAAAATTGCCGAGGGATTTATTCCTCGCACTCTCGATGCGCGGGTGGATGCAC
GGCTCAGTGCGCTGCTTGAGGCCCGGGAAGCTGAAGGCAGCCTTGCCCGGGCGCTTTTCACGCCGGATAC
GCCGGAACCCGGGCCAGCTGATACAGACAGTCACGCCAGTGAACAACCTGAGCCGGTCAGCCCGCCTGCG
CCAGCAGTAATGACGGTAACTCCTGCACCGGTAAAATCGCCGCCGACAACAAAGCGTCCGGCAGCGGAGC
CTTCCGTCAGAGCAACGGAGCCTCCCGTCCTGCGGGGCACGACCGTACCGTTGATCAAACCAAAAGCAGC
CGCAGCGGCCACTGCTGCCTCAACAGCATCCTCTGCCGGTGCCCCTGCGGCAGCTGCAGGCGGGACAGAA
CAGGAACTGGCGCAGCAGTCAGCGGAACAGGGACAGGACATGCTGCCGGCCGGCATGAACGAGGACGGCG
TCATCGAGGACATGCAGGCGTATGACGCCTGGCTGGCAGATGAGCAGACACAGCGGGATATGCAGCGGCG
TGAAGAGGTCAATATCAACCACAGCCACCGCCACGATGAACAGGATGATGTCGAGATTGGGGGGAACTTC
TGA
 Primer design