SecReT4
Protein ID: 152973594
T4SS name [ID]Tra_F [112]
Gene symboltraI
Locus tagKPN_pKPN3p06036
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN3 [GenBank: NC_009649] [Browse all T4SS(s) in this replicon]
Location [Strand]169040..174301 [+]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDA6TIJ2
KEGG IDkpn:KPN_pKPN3p06036, kpn:KPN_pKPN4p07159
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 2.3e-84, Aligned region: 7..288
TraI [PF07057], Evalue: 1.3e-57, Aligned region: 1433..1558
AAA_30 [PF13604], Evalue: 2.7e-43, Aligned region: 971..1158
UvrD_C_2 [PF13538], Evalue: 1e-05, Aligned region: 1340..1443
Protein Sequence: 1753 a.a.     [Download]
>gi|152973594|ref|YP_001338645.1| conjugal transfer nickase/helicase TraI [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MMSIGSVKSAGSAGNYYTDKDNYYVIGSMDERWQGKGAEALGIDGKAVDKALFTELLKGKLPDGSDLTRI
QDGANRHRPGYDLTFSAPKSVSVMAMLGGDKRLIDAHNQAVTEAVRQLETLAATRVMTDGKSETVLTGNL
IVAKFNHDTNRNQEPQIHTHAVVINATQNGDKWQSLGTDKIGKTGFIENVYANQIAFGKLYREAFKPLVE
KLGYETEVVGKHGMWEMKGVPVEPFSTRSQEVREAAGPDASLKSRDVAALDTRKSKEAIDPAEKMVEWMN
TLKETGFDIRGYREAADARAAELARAPAAPVNTDGPDITDVVTKAIAGLSDRKVQFTYADLLARTVGQLE
AKDGVFDLARKGIDAAIEREQLIPLDREKGLFTSNIHVLDELAVKALSQEVQRQNHVSVTPDASVVRQVP
FSDAVSVLAQDRLVMGIVSGQGGATGQRERVAELTLMAREQGRDVHILAADNRSRDFLAGDVRLAGETVT
GKSALQDGTAFIPGGTLIVDQAEKLSLKETISLLDGAMRHNVQVLLSDSGKRSGTGSALTVLKDSGVNTY
RWQGGQQTTADIISEPDKGARYSRLAQEFAVSVREGQESVAQISGTREQSVLNGLIRDSLRQEGVLGEKD
TTITALTPVWLDSKSRGVRDYYREGMVMERWDPENRTHDRFVIDRVTASSNMLTLKDRDGVRLDLKVSAV
DSQWTLFRAETLPVAEGERLAVLGKIPDTRLKGGESITVMKVEEGQLTVQRPGQKTTQTLAVGAGVFDGI
KIGHGWVESPGRSVSETATVFASVTQRELDNATLNQLAQSGSHLRLYSAQDAARTTEKLSRHTAFSVVSE
QLKSRSGETDLDAAIAQQKAGLHTPAEQAIHLAIPLLESQDLTFSRPQLLATAMETGGGKVSMADIDTTI
QAQIRSGQLLNVPVAHGYGNDLLISRQTWDAEKSILTHVLEGKDAVAPLMDRVPASLMTDLTAGQRAATR
MILESTDRFTVVQGYAGVGKTTQFRAVMSAISLLPEETRPRVIGLAPTHRAVGEMQSAGVDARTTASFLH
DTQLLQRNGQTPDFSNTLFLLDESSMVGLADMAKAHSLIVAGGGRAVSSGDNDQLQPIAPGQPFRLMQQR
SAADVAIMKEIVRQMPELRPAVYSLIERDVHRALTTIEQVTPEQVPRKEGAWAPGSSVVEFTPKQEKAIE
KALSEGKTLPEGQPATLYEALVKDYTGRTPEAQSQTLVITHLNKDRRALNSLIHDARRENGETGKEEITL
PVLVTSNIRDGELRKLSTWTAHKEAVALVDNVYHRISKVDKDNQLITLTDSEGKERFISPREASAEGVTL
YRQEKITVSQGDRMRFSKSDPERGYVANSIWEVQSVSGDSVTLSDGKITRTLTPKAEQAQQHIDLAYAIT
AHGAQGASEPYAIALEGVAGGREQMASFESAYVALSRMKQHVQVYTDNREGWIKAIKNSPEKATAHDILE
PRNDRAVKTADLLFGRARPLDETAAGRAALQQSGLAQGSSPGKFISPGKKYPQPHVALPAFDKNGKAAGI
WLSPLTDRDGRLEAIGGEGRIMGNEDARFVALQNSRNGESLLAGNMGEGVRMARDNPDTGVVVRLAGDDR
PWNPGAMTGGRVWAEPAPVAPVPQAGADIILPPEVLAQRAAEEQQRREMEKKAEQTAREMAGEARKAGEP
ADRVKEVIGDVIRGLERDRPGTEKTTLPDDPQFRRQEEAIQQVASERLQRERLQAVERDMVRDLNREKTL
GGD
 
Nucleotide Sequence: 5262 bp     [Download]
>gi|152973416|ref|NC_009649.1|:169040-174301 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence
ATGATGTCGATTGGCTCCGTTAAATCGGCGGGCAGTGCCGGTAATTACTATACGGATAAGGATAATTACT
ACGTCATAGGGAGCATGGACGAACGCTGGCAGGGTAAGGGGGCTGAGGCGCTGGGGATCGACGGGAAAGC
CGTGGATAAGGCGCTGTTTACGGAACTGCTGAAAGGGAAGCTGCCGGATGGCAGCGACCTGACCCGAATA
CAGGACGGCGCCAACAGGCACCGGCCCGGTTATGACCTGACCTTCTCGGCCCCCAAAAGCGTGTCGGTCA
TGGCGATGCTGGGCGGCGATAAACGCCTTATCGATGCCCACAACCAGGCGGTAACCGAAGCGGTGCGGCA
ACTGGAGACGCTGGCCGCGACCCGTGTCATGACGGACGGTAAAAGCGAAACGGTGCTGACCGGAAATCTG
ATTGTGGCGAAATTCAACCACGACACGAACCGTAACCAGGAACCTCAGATACACACCCATGCCGTCGTCA
TTAACGCCACGCAGAACGGGGACAAATGGCAGTCTCTCGGCACAGATAAGATCGGTAAAACAGGTTTTAT
CGAGAACGTGTACGCGAACCAGATAGCGTTCGGGAAGCTTTACCGGGAGGCGTTCAAACCCCTGGTTGAG
AAGCTTGGCTATGAGACGGAAGTCGTGGGCAAACACGGGATGTGGGAGATGAAAGGGGTCCCTGTGGAAC
CCTTCTCCACCCGGTCTCAGGAGGTCAGGGAGGCTGCAGGACCCGATGCCTCCCTGAAGTCACGGGATGT
GGCCGCGCTCGATACCCGCAAGTCGAAAGAAGCCATCGATCCGGCAGAGAAGATGGTGGAGTGGATGAAC
ACGCTGAAGGAGACCGGGTTTGACATCCGGGGGTACCGTGAGGCCGCCGATGCGCGAGCCGCAGAGCTGG
CCCGTGCACCTGCCGCGCCGGTGAACACTGACGGTCCGGATATCACGGATGTGGTGACGAAAGCGATTGC
CGGTCTCAGCGACCGCAAGGTGCAATTCACGTATGCCGACCTGCTGGCACGCACGGTCGGCCAGCTGGAG
GCGAAGGACGGTGTGTTTGATCTGGCGAGAAAGGGCATCGATGCCGCCATTGAACGGGAGCAGCTTATCC
CTCTCGATCGCGAGAAAGGCCTGTTCACCTCAAACATCCACGTTCTCGATGAACTCGCCGTCAAAGCCCT
GAGTCAGGAGGTACAGCGCCAGAATCATGTCTCCGTCACGCCCGATGCGTCTGTGGTGCGCCAGGTCCCT
TTCAGCGATGCCGTCAGCGTGCTGGCGCAGGATCGCCTGGTAATGGGTATTGTTTCCGGTCAGGGCGGTG
CAACCGGCCAGCGGGAGCGGGTGGCCGAGTTAACCCTGATGGCCCGGGAGCAGGGGCGTGACGTCCATAT
CCTGGCGGCCGATAACCGCTCACGTGATTTTCTCGCCGGTGATGTGCGTCTGGCCGGGGAAACGGTGACC
GGTAAATCCGCCCTGCAGGACGGGACGGCGTTTATTCCGGGCGGAACACTCATCGTGGATCAGGCGGAGA
AGCTGAGCCTGAAGGAAACGATTTCCCTGCTCGATGGCGCGATGCGCCATAACGTGCAGGTCCTGCTCTC
AGACAGCGGGAAGCGCAGCGGGACCGGCAGTGCGCTGACGGTGCTGAAGGACAGCGGCGTGAATACGTAT
CGCTGGCAGGGCGGCCAACAGACCACAGCCGACATCATCAGTGAACCGGATAAAGGAGCACGCTACAGCC
GGCTGGCACAGGAGTTTGCCGTCAGCGTACGTGAAGGGCAGGAAAGCGTGGCCCAAATCAGCGGGACGCG
TGAACAGAGCGTACTCAACGGCCTTATCCGTGACTCCCTCAGACAGGAGGGGGTGCTGGGTGAGAAAGAC
ACGACCATTACAGCCCTGACGCCGGTGTGGCTGGACAGTAAAAGCCGGGGCGTGCGGGATTATTACCGGG
AGGGGATGGTGATGGAACGCTGGGATCCGGAGAACCGGACGCACGATCGCTTTGTCATTGACCGGGTGAC
CGCGAGCAGCAATATGCTGACCCTGAAAGACCGGGATGGGGTCCGTCTGGATCTGAAGGTTTCCGCGGTC
GACAGCCAGTGGACGCTGTTCCGGGCAGAGACACTGCCGGTGGCAGAGGGGGAACGTCTGGCGGTGCTCG
GGAAGATACCGGACACACGCCTGAAGGGCGGGGAAAGCATCACGGTGATGAAAGTGGAGGAAGGGCAGCT
GACGGTACAGCGGCCGGGGCAGAAAACCACGCAGACCCTGGCCGTGGGCGCGGGCGTGTTTGACGGTATT
AAAATCGGCCACGGCTGGGTGGAAAGTCCCGGCAGGTCGGTTAGCGAGACGGCAACGGTCTTTGCGTCGG
TGACGCAGCGTGAGCTGGATAACGCCACCCTCAACCAGCTGGCGCAGAGCGGAAGTCATCTCCGGCTGTA
CTCGGCGCAGGATGCGGCGCGTACGACGGAGAAGCTGTCGCGGCATACCGCGTTCAGCGTGGTCTCAGAG
CAGCTGAAGTCCCGATCCGGCGAGACGGACCTGGATGCGGCCATTGCGCAGCAGAAGGCCGGGCTGCATA
CCCCGGCAGAACAGGCCATTCACCTGGCCATCCCGCTGCTTGAGAGCCAGGACCTGACCTTCTCCCGGCC
CCAGCTGCTGGCGACGGCAATGGAAACCGGGGGCGGGAAGGTTTCGATGGCGGACATCGACACGACCATC
CAGGCACAAATCAGGTCGGGGCAGTTGCTGAATGTACCGGTGGCGCACGGCTACGGCAATGACCTGCTGA
TTTCCCGTCAGACCTGGGACGCCGAAAAAAGCATCCTGACCCACGTGCTGGAAGGTAAAGACGCGGTGGC
CCCCCTGATGGACCGCGTGCCGGCCAGTCTGATGACGGACCTGACCGCCGGACAGCGGGCGGCGACCCGG
ATGATTCTGGAAAGCACGGACCGCTTCACGGTGGTTCAGGGGTATGCCGGGGTGGGGAAAACCACCCAGT
TCCGGGCAGTCATGAGTGCCATCAGTCTGCTGCCGGAAGAGACCCGTCCGCGCGTCATCGGTCTGGCGCC
GACGCATCGCGCGGTCGGGGAAATGCAGAGTGCTGGCGTGGATGCGCGCACGACGGCATCGTTCCTCCAC
GACACGCAGCTGCTGCAGCGCAATGGCCAGACACCCGATTTCAGCAACACCCTGTTCCTGCTCGACGAGA
GCTCAATGGTGGGGCTGGCCGATATGGCAAAAGCCCACTCCCTCATCGTCGCCGGCGGTGGACGGGCGGT
GTCCAGTGGGGATAACGACCAGCTGCAGCCCATCGCGCCGGGCCAGCCGTTCAGGTTGATGCAGCAGCGC
AGCGCCGCCGACGTTGCCATCATGAAAGAGATTGTACGCCAGATGCCTGAGCTGCGACCGGCGGTCTACA
GCCTGATTGAGCGGGATGTGCACCGCGCCCTGACCACCATCGAGCAGGTCACGCCGGAGCAGGTGCCGAG
AAAAGAAGGCGCATGGGCGCCGGGCAGTTCTGTGGTGGAATTCACGCCAAAGCAGGAAAAGGCGATAGAA
AAGGCGCTGAGCGAGGGGAAAACCCTGCCGGAAGGTCAGCCCGCGACGCTCTACGAGGCGCTGGTGAAGG
ACTATACCGGACGGACCCCGGAGGCACAGTCGCAGACGCTGGTGATCACCCATCTGAATAAGGACCGGCG
GGCGCTGAACAGTCTGATCCATGACGCACGGCGGGAGAACGGGGAAACCGGCAAAGAGGAAATCACCCTG
CCGGTGCTGGTCACGAGTAACATCCGTGACGGTGAACTGCGCAAACTGTCGACCTGGACGGCTCACAAGG
AGGCGGTGGCGCTGGTTGATAACGTATACCACCGTATCAGCAAGGTGGATAAGGATAATCAGCTGATCAC
CCTGACAGACAGTGAAGGAAAGGAGCGATTTATCTCACCCCGGGAGGCATCGGCAGAAGGCGTCACGCTC
TATCGTCAGGAAAAGATCACCGTGTCTCAGGGGGACCGAATGCGCTTCAGCAAAAGTGACCCGGAGCGCG
GCTATGTGGCCAACAGTATCTGGGAAGTGCAGTCTGTTTCGGGTGACAGTGTCACGCTGTCTGATGGCAA
AATCACCCGTACGCTGACCCCGAAGGCGGAGCAGGCACAGCAGCATATCGACCTCGCCTACGCCATCACC
GCCCACGGTGCCCAGGGGGCCAGCGAACCGTATGCCATCGCGCTGGAAGGGGTGGCCGGTGGTCGGGAAC
AGATGGCCAGCTTTGAGTCTGCCTATGTGGCTTTATCCCGCATGAAACAGCATGTTCAGGTCTACACCGA
CAACCGTGAGGGCTGGATAAAGGCCATCAAGAATTCACCTGAGAAAGCGACGGCGCACGATATTCTTGAA
CCCCGTAACGACCGGGCGGTGAAAACAGCCGATCTGCTGTTCGGGCGGGCAAGGCCACTGGATGAAACCG
CCGCGGGCCGGGCAGCCCTGCAGCAGTCCGGTCTGGCACAGGGAAGTTCACCAGGAAAATTCATTTCTCC
GGGGAAAAAGTACCCTCAGCCGCATGTGGCGCTGCCGGCATTTGATAAAAACGGGAAAGCCGCCGGTATC
TGGCTCAGCCCGCTGACCGATCGGGACGGACGGCTGGAGGCTATCGGCGGAGAGGGACGAATTATGGGCA
ATGAAGACGCCCGGTTCGTGGCGCTGCAGAACAGCCGCAACGGAGAAAGCCTGCTGGCCGGGAATATGGG
GGAAGGCGTCAGAATGGCCCGCGACAATCCCGATACGGGGGTGGTGGTGCGGCTGGCCGGTGATGACCGC
CCCTGGAACCCCGGGGCCATGACCGGTGGGCGGGTATGGGCTGAACCGGCGCCGGTGGCTCCGGTACCGC
AGGCCGGGGCTGACATTATCCTCCCGCCAGAGGTACTGGCACAGCGGGCGGCAGAAGAACAGCAGCGCCG
GGAAATGGAAAAAAAGGCGGAACAGACTGCCCGGGAAATGGCCGGGGAGGCGCGTAAAGCCGGCGAGCCG
GCGGACCGGGTGAAAGAGGTTATCGGGGACGTCATTCGCGGACTGGAGCGTGACCGGCCGGGTACGGAGA
AAACGACGCTACCGGATGATCCTCAGTTCCGGCGCCAGGAGGAGGCGATTCAACAGGTGGCCTCAGAACG
TCTGCAGCGTGAGCGTCTGCAGGCTGTGGAGCGGGACATGGTTCGTGACCTTAACCGCGAGAAAACCCTC
GGGGGCGACTGA
 Primer design