SecReT4
Protein ID: 152973697
T4SS name [ID]Tra_F [98]
Gene symboltraL
Locus tagKPN_pKPN4p07128
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN4 [GenBank: NC_009650] [Browse all T4SS(s) in this replicon]
Location [Strand]74806..75111 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDA6TIT4
KEGG IDkpn:KPN_pKPN4p07128
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.2e-38, Aligned region: 8..101
Protein Sequence: 101 a.a.     [Download]
>gi|152973697|ref|YP_001338737.1| conjugal transfer pilus assembly protein TraL [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MTGDELKRYRFPETLTNQSRWFGLYLDELIPAVICLGWGFWTSKFIFGIASAVLVFWGIKKLKKGRGSSW
LRDLIYWYLPTSLLKGFFHDVPDSCFRQWIK
 
Nucleotide Sequence: 306 bp     [Download]
>gi|152973607|ref|NC_009650.1|:74806-75111 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN4, complete sequence
ATGACGGGAGACGAATTAAAGCGATACCGTTTCCCGGAAACACTGACTAACCAGTCCCGCTGGTTTGGCT
TATATCTCGATGAACTTATCCCGGCCGTGATTTGTCTCGGCTGGGGTTTCTGGACCAGCAAGTTCATTTT
TGGCATAGCTTCAGCGGTACTGGTTTTCTGGGGTATCAAGAAACTGAAAAAAGGGCGGGGCAGTTCCTGG
CTACGCGACCTGATTTACTGGTATCTGCCAACCTCCCTTCTTAAAGGTTTCTTTCATGATGTTCCGGACT
CCTGTTTCCGGCAGTGGATTAAATAA
 Primer design