SecReT4
Protein ID: 152973718
T4SS name [ID]Tra_F [98]
Gene symboltraF
Locus tagKPN_pKPN4p07149
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN4 [GenBank: NC_009650] [Browse all T4SS(s) in this replicon]
Location [Strand]89713..90465 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDA6TII2
KEGG IDkpn:KPN_pKPN3p06026, kpn:KPN_pKPN4p07149
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.4e-77, Aligned region: 26..240
Protein Sequence: 250 a.a.     [Download]
>gi|152973718|ref|YP_001338758.1| conjugal pilus assembly protein TraF [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAVPAAPPPQMDILEKLATLQAATKRSLY
EAILYPSSENFVKYFRLQNYWTQQAGLFSMSAKKAMLENPELDYNLQYSHYNGTVKNQLAADYAEQRQAI
STLAQHYGVMFFYRGREAIDGQLVQVIKNFRETYGLSVIPVSVDGVINPMLPDSRTDQGQAEQLGVKFFP
AMMLVNPKSGQVKPLSYGFISQDDLAKQFLYVSSDFKPNF
 
Nucleotide Sequence: 753 bp     [Download]
>gi|152973607|ref|NC_009650.1|:89713-90465 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN4, complete sequence
ATGCGAACAATACATGCCGCCATGCTGGCGGGGTGCCTTTGCTGCGCCCTGATGCCGGCTTTCGCCAAAG
ACGCGGGCTGGCAGTGGTACAACGAGAAACTGAAGCCCCGTGATGAGGACAGGAAAGCCGTACCAGCGGC
ACCACCGCCGCAAATGGATATTCTGGAGAAACTCGCCACACTCCAGGCGGCCACCAAACGGTCGTTGTAC
GAAGCCATTCTGTATCCATCGTCTGAAAACTTCGTGAAGTATTTCCGGCTGCAGAACTACTGGACGCAGC
AGGCAGGTTTGTTCTCGATGAGTGCGAAGAAAGCCATGCTGGAAAACCCCGAACTCGATTACAACCTGCA
GTACAGCCACTACAACGGCACGGTAAAAAACCAGCTCGCTGCCGACTATGCCGAACAGCGACAGGCTATC
TCCACCCTCGCACAGCACTACGGCGTGATGTTCTTCTACCGGGGCCGGGAAGCGATCGATGGCCAGCTGG
TCCAGGTGATTAAAAATTTTCGCGAAACCTATGGCCTGAGCGTGATACCGGTGTCGGTTGACGGAGTGAT
TAACCCCATGCTGCCCGACAGCCGGACGGACCAGGGCCAGGCAGAGCAGCTTGGCGTGAAGTTCTTCCCC
GCGATGATGCTGGTTAACCCGAAAAGTGGCCAGGTGAAGCCTCTCAGTTACGGCTTTATCAGTCAGGACG
ACCTGGCGAAACAGTTCCTCTATGTCTCCAGCGACTTTAAACCGAATTTCTAA
 Primer design