SecReT4
Protein ID: 152973719
T4SS name [ID]Tra_F [98]
Gene symboltraQ
Locus tagKPN_pKPN4p07150
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN4 [GenBank: NC_009650] [Browse all T4SS(s) in this replicon]
Location [Strand]90476..90715 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDA6TIV6
KEGG IDkpn:KPN_pKPN4p07150
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 6.8e-35, Aligned region: 1..71
Protein Sequence: 79 a.a.     [Download]
>gi|152973719|ref|YP_001338759.1| conjugal transfer pilin chaperone TraQ [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MRNIRFPDLDITGMWVLAVGVFFHLIARLVRKQPELAVQAGEIFGLGMVVFGGYRILNALIAEAEKEEKA
CEKQPDEPR
 
Nucleotide Sequence: 240 bp     [Download]
>gi|152973607|ref|NC_009650.1|:90476-90715 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN4, complete sequence
ATGCGAAATATTCGTTTTCCGGATTTAGATATCACCGGGATGTGGGTGCTGGCCGTGGGCGTGTTTTTCC
ACCTGATAGCCCGGCTTGTCAGAAAACAGCCTGAGCTGGCCGTCCAGGCCGGGGAAATCTTCGGGCTGGG
TATGGTGGTGTTCGGGGGATACCGCATTCTAAACGCCCTGATTGCTGAAGCCGAAAAAGAGGAGAAAGCC
TGTGAAAAACAGCCTGATGAACCTCGCTAA
 Primer design