SecReT4
Protein ID: 152973729
T4SS name [ID]Tra_F [98]
Gene symboltraX
Locus tagKPN_pKPN4p07160
StrainKlebsiella pneumoniae subsp. pneumoniae MGH 78578
Repliconplasmid pKPN4 [GenBank: NC_009650] [Browse all T4SS(s) in this replicon]
Location [Strand]106078..106803 [+]
ProductF pilin acetylation
Component typeTraX_F
UniProt IDA6TIJ3
KEGG IDkpn:KPN_pKPN3p06037, kpn:KPN_pKPN4p07160
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 9.3e-52, Aligned region: 25..239
Protein Sequence: 241 a.a.     [Download]
>gi|152973729|ref|YP_001338769.1| F pilin acetylation [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MRAQHTFPGATDRWLHRLLTWAPGQTDMIKTVALVLMVTDHTGLLLAGNNEVMRLLGRGCFPLFGLAWGM
NLARHAEIRQSQLNSLWGWALVAQVSFMLIGYPWYSGNILFAFAVTGQVLRWVSQPSWYYTLPAAGLLVA
WIPLSTASYGMAGVGMLTASWLLCRAQHAQERLGYGVLWALMVLLMNMHDVSESVAGLAIALLTLMVCSS
AGERVKRFWPRQFFVMFYAVHLAVLGIVVSM
 
Nucleotide Sequence: 726 bp     [Download]
>gi|152973607|ref|NC_009650.1|:106078-106803 Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN4, complete sequence
ATGAGAGCACAACACACATTTCCAGGTGCGACAGACCGCTGGCTTCATCGCCTGCTGACCTGGGCACCGG
GACAAACGGATATGATTAAAACGGTCGCACTGGTACTGATGGTGACTGACCACACCGGCTTACTGCTGGC
CGGAAACAATGAAGTGATGCGCCTGCTGGGACGGGGCTGTTTTCCGCTGTTCGGTCTGGCATGGGGAATG
AATCTGGCCCGGCACGCGGAAATACGCCAGTCGCAGCTGAACAGCCTGTGGGGCTGGGCGCTGGTCGCCC
AGGTGTCGTTTATGCTCATCGGGTACCCGTGGTATTCCGGGAATATTCTGTTTGCCTTTGCCGTCACGGG
CCAGGTCCTGCGGTGGGTCAGCCAGCCGTCCTGGTATTACACCCTCCCGGCGGCTGGACTGCTGGTCGCC
TGGATACCCCTGTCAACCGCCAGCTACGGCATGGCCGGAGTGGGCATGCTCACCGCCAGCTGGCTGCTTT
GTCGCGCACAGCATGCACAGGAACGGCTGGGATACGGGGTGCTGTGGGCCCTCATGGTGTTGCTGATGAA
TATGCATGACGTGAGTGAATCAGTGGCCGGGCTGGCGATTGCGCTGCTGACGCTGATGGTGTGCTCATCT
GCCGGAGAACGTGTGAAACGCTTCTGGCCGCGGCAGTTCTTCGTGATGTTCTATGCGGTGCACCTGGCGG
TACTCGGTATTGTCGTCTCGATGTAA
 Primer design