SecReT4
Protein ID: 152983900
T4SS name [ID]Trb [327]
Gene symbol-
Locus tagPSPA7_3698
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]3833901..3834893 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA6V7L7
KEGG IDpap:PSPA7_3698
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.2e-67, Aligned region: 103..322
Protein Sequence: 330 a.a.     [Download]
>gi|152983900|ref|YP_001349052.1| conjugal transfer protein TrbG/VirB9/CagX [Pseudomonas aeruginosa PA7]
MNDLFRKSALPVILLALAGCATQGKPPPTISLDEPVQAQPLPEPPAPVEVVAVPEVLPMPAQLKPLPEAE
DAKPTPEPADEKVRISRANAEARVAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVISLQPGEELVTVA
AGDTVRWIVGDTSSGSGADLRVNVLVKPIRSGLKTNLVITTNRRTYLLELASTEKTWMASVSWEYPRDRM
LALQRQAQAASAAAPVDTGLSLENLRFRYAISGSSPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVIG
AQGDGQLVNYRFRSPYFIVDRLFGAAELRLGGDKGDVVRIERTDGVARRN
 
Nucleotide Sequence: 993 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3834893-3833901 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAATGATCTTTTCCGTAAATCCGCCTTGCCGGTGATCTTGCTTGCCCTGGCGGGCTGCGCCACGCAGG
GCAAGCCACCGCCGACCATCTCGCTCGATGAGCCGGTGCAGGCCCAGCCGCTACCCGAGCCACCCGCGCC
GGTGGAGGTGGTGGCGGTGCCCGAGGTGCTGCCGATGCCGGCGCAGTTGAAGCCATTGCCCGAAGCCGAG
GACGCCAAGCCCACGCCGGAGCCAGCCGACGAGAAGGTGCGCATCTCACGGGCCAATGCCGAGGCGCGCG
TCGCACCCACGCGCGAGGGATACGTCAACGCGATTCAGGTGTGGCCGTTCACCGATGGCGCGCTCTACCA
AGTCTATGCAGCCGTGGGCCGCGTGACCGTGATTTCGCTCCAGCCGGGCGAGGAGCTGGTGACGGTGGCC
GCTGGTGATACCGTGCGCTGGATCGTGGGCGATACGTCGAGCGGCAGCGGCGCCGACCTGCGCGTCAATG
TGCTGGTCAAGCCGATCCGATCGGGCCTCAAGACCAATCTCGTCATCACCACCAACCGCAGGACGTACCT
GCTGGAGTTGGCTTCGACGGAAAAGACGTGGATGGCGTCGGTGTCCTGGGAGTACCCGCGCGACCGGATG
CTGGCCTTGCAGCGCCAGGCGCAGGCGGCCAGCGCCGCCGCGCCGGTCGATACCGGGCTGTCGCTGGAGA
ACCTGCGCTTCCGCTACGCGATCAGCGGCAGCAGTCCGCCGTGGAAGCCGCTGCGCGCGTTCGACGACGG
CGAGAAGGTCTATATCCAGTTCCCGCCGGGCATCGCCCAAGGCGAGCTGCCGCCGCTGTTCGTCATCGGC
GCGCAGGGTGATGGGCAACTGGTGAACTACCGTTTCCGCTCGCCGTATTTCATCGTCGATCGGCTGTTCG
GCGCCGCCGAGCTGCGGCTGGGTGGCGACAAGGGCGACGTGGTGCGGATCGAGCGCACGGACGGCGTTGC
GCGGAGGAACTGA
 Primer design