SecReT4
Protein ID: 152984218
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4523
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4650071..4651582 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDA6V9Y8
KEGG IDpap:PSPA7_4523
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.2e-123, Aligned region: 10..489
Protein Sequence: 503 a.a.     [Download]
>gi|152984218|ref|YP_001349873.1| hypothetical protein PSPA7_4523 [Pseudomonas aeruginosa PA7]
MTFMTNDYLEYYLTLLGWIINNGIWNMISDTGLFAVPFVAIVMREWLKVRGEGADEGNKGVLSLARIETH
IYVGYIVVALAGIPVVNVSFDTIEFDQARAQQCQYNLPAPADTGWSTSFSSLAGKSAQMPLWWAMMHALS
KGFTAGAVAAIPCGTDLRQMRMEVDNTRVNNPLLAQEIADFSRDCYGPSRARLFMRQPDLGSIAEDNKAL
QDLNWIGSRFLLNTPGYYDTDYSKSPRQSWPYNATRDAGLPQVGGGGGYPTCKQWWADSGIGLRDRIKGQ
VDPDLMTSFLKWAKWLNQDEVTEAVIRQVISPSSQVKGNVYTDYGGQVGGTVWNGIARTAGTFGVALGSL
AYFPAMDMVRQALPMVMSFLKMAMVICIPMVLVIGTYQLKVAMTMTVVFFAMMFVDFWFQLARYIDSTIL
DAFYGSGSPHLSFDPVMGLNTATQDAILNFVMGSMFIVLPLLWMTAIGWSGIQAGSVLNGLSRGTEGVQA
AGKEAGNRVKNAV
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4650071-4651582 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGACCTTCATGACCAATGACTACCTGGAGTATTACCTCACCCTCCTCGGTTGGATCATCAACAACGGGA
TCTGGAACATGATCTCGGATACAGGGCTGTTCGCGGTGCCCTTCGTGGCCATTGTGATGCGTGAGTGGCT
GAAAGTTCGCGGGGAAGGCGCCGACGAGGGCAACAAAGGCGTGCTGTCTCTGGCCCGCATCGAGACGCAT
ATCTACGTCGGATACATCGTGGTCGCCCTGGCGGGAATCCCGGTCGTCAACGTGAGCTTCGACACCATCG
AGTTCGACCAGGCCCGCGCCCAGCAGTGCCAGTACAACCTGCCGGCGCCGGCAGACACCGGCTGGTCGAC
CTCCTTCAGCAGCCTGGCCGGCAAGAGTGCGCAGATGCCGCTCTGGTGGGCGATGATGCACGCCCTGTCC
AAGGGCTTCACCGCCGGCGCGGTCGCGGCCATTCCGTGCGGCACGGATCTGCGGCAGATGCGAATGGAAG
TGGACAATACGCGCGTGAACAACCCGCTGCTGGCACAAGAAATCGCTGACTTTTCCAGGGACTGCTACGG
ACCTTCCCGTGCGCGGCTGTTCATGCGGCAACCCGATCTGGGCTCCATCGCCGAGGACAACAAGGCGCTG
CAGGACCTGAACTGGATCGGCTCCCGATTCCTGTTGAACACCCCGGGGTACTACGACACCGACTACTCGA
AGAGTCCCCGTCAGTCGTGGCCCTACAACGCCACCCGCGACGCCGGGCTGCCCCAGGTGGGCGGTGGTGG
TGGCTACCCAACCTGCAAGCAGTGGTGGGCTGACTCAGGGATCGGCTTGCGTGATCGGATCAAGGGCCAG
GTGGATCCGGACCTGATGACCAGCTTCCTCAAGTGGGCGAAATGGCTGAACCAGGACGAGGTAACCGAGG
CAGTCATTCGCCAGGTGATCTCCCCCTCCAGCCAGGTCAAGGGCAACGTCTATACCGATTACGGCGGGCA
GGTTGGCGGCACCGTCTGGAACGGCATCGCGAGAACCGCAGGAACCTTCGGCGTTGCCCTGGGCAGCCTG
GCCTATTTCCCGGCGATGGATATGGTCCGCCAAGCGCTGCCGATGGTGATGTCGTTCCTCAAGATGGCCA
TGGTCATCTGCATTCCGATGGTCCTGGTCATCGGCACCTATCAACTGAAAGTTGCCATGACGATGACGGT
CGTCTTCTTTGCGATGATGTTCGTCGATTTCTGGTTTCAGTTAGCCAGATATATCGATAGCACGATACTT
GATGCCTTCTATGGTTCGGGATCACCGCATCTTTCATTTGACCCAGTCATGGGGCTGAATACGGCTACTC
AAGATGCGATCTTGAACTTCGTTATGGGTTCTATGTTCATTGTTTTACCACTACTGTGGATGACAGCGAT
CGGCTGGTCCGGAATTCAAGCAGGGTCTGTTCTGAACGGATTGAGCAGAGGGACTGAAGGAGTTCAAGCC
GCCGGCAAGGAAGCAGGAAATAGAGTTAAAAACGCAGTTTGA
 Primer design