SecReT4
Protein ID: 152984461
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4521
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4648345..4649727 [+]
Productputative integral membrane protein
Component typeTfc22
UniProt IDA6V9Y6
KEGG IDpap:PSPA7_4521
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 460 a.a.     [Download]
>gi|152984461|ref|YP_001349871.1| putative integral membrane protein [Pseudomonas aeruginosa PA7]
MRMNITSVALTCLLAAQLAQADDPINVSKTGTVLSDEVLYSIGGGSAVSMGSAGQMDSIGVGFGWNNDLM
CGNMNLSTTLENQLNGATQGFQNIMGSVIQNATGAVMSLPALIIQRANPQLYNLITNGILQARIDYDRSK
GTCRAIAEKMADIAGEQTGWGKIAEGQALGATLASGGKDAVSALEAVEKKGGNDGITWVGGDKAGGSGQK
PIRIVNDVTRAGYNLLTSRSVNDSSSVPSATCNNGLVCNTWSSPQEAAAFATRVLGEQQQQTCEGCQKTV
TAAGVGLTPLIQETYDKKLQSLQELLSKSKPLTAENLAAAGTDALPITRGVIEALRDERDQDVLARRLAS
DVSLMDVLSKALLLQRLMFAGAKEPNVAANGLATQAVDQQTSLLQQEISNLKTELELRRELASNSPMRVI
ERGQQRASGSSGVFESAPDADRLDRLQAPSAADGKTGGRP
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4648345-4649727 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCGAATGAACATCACCTCGGTCGCGCTGACGTGCCTGCTCGCAGCGCAACTTGCCCAGGCCGACGACC
CGATCAATGTGTCCAAGACCGGCACGGTTCTCAGCGACGAGGTCCTCTACAGCATTGGCGGCGGCAGTGC
GGTGAGCATGGGCAGCGCCGGCCAGATGGACTCGATCGGCGTCGGCTTCGGCTGGAACAACGACCTTATG
TGCGGAAACATGAACCTGAGCACCACCCTGGAGAACCAGCTCAACGGTGCCACACAGGGTTTCCAGAACA
TCATGGGCTCAGTCATCCAGAACGCGACCGGCGCAGTCATGTCGCTGCCGGCGTTGATCATCCAGCGCGC
GAACCCTCAGCTCTACAACCTGATCACCAATGGCATCCTGCAGGCGCGGATCGACTACGACCGCTCGAAA
GGGACTTGCAGAGCGATCGCCGAGAAGATGGCTGACATCGCTGGCGAGCAGACCGGCTGGGGGAAAATCG
CCGAAGGCCAGGCCCTGGGTGCCACACTGGCCTCTGGCGGGAAAGACGCCGTATCCGCCCTCGAAGCAGT
GGAGAAGAAGGGCGGCAACGATGGCATAACCTGGGTCGGTGGAGACAAGGCCGGCGGCTCCGGCCAGAAG
CCCATTCGCATCGTCAACGACGTGACCCGGGCGGGCTACAACCTGTTGACCAGCCGCTCAGTGAATGACT
CGTCGAGCGTGCCTTCCGCCACTTGCAACAACGGCCTGGTCTGCAACACCTGGTCCTCCCCCCAGGAAGC
CGCCGCGTTCGCCACCCGGGTTCTGGGCGAACAACAGCAACAGACCTGTGAAGGCTGTCAGAAGACGGTG
ACGGCGGCAGGCGTCGGCCTGACCCCGCTGATCCAAGAGACCTACGACAAGAAGCTCCAGTCGCTGCAGG
AGCTGCTGTCGAAAAGTAAGCCACTGACCGCCGAGAACCTGGCTGCGGCCGGCACCGATGCCTTGCCGAT
CACCCGCGGCGTCATCGAGGCGCTGCGCGACGAGCGTGACCAGGACGTCCTGGCGCGCCGCCTGGCGTCC
GATGTCTCCCTGATGGACGTGCTCAGCAAGGCCCTGTTGTTGCAGCGCCTGATGTTCGCCGGCGCCAAGG
AGCCCAACGTCGCCGCCAACGGCCTGGCCACCCAAGCCGTCGATCAGCAGACCAGCCTCCTGCAGCAGGA
GATCTCCAATCTCAAGACCGAACTGGAACTCCGTCGCGAGTTGGCCAGCAATTCGCCCATGCGGGTCATC
GAGCGCGGGCAACAGCGCGCCTCAGGGTCCAGTGGCGTGTTCGAGTCGGCGCCCGATGCCGATCGCCTCG
ATCGCCTGCAGGCCCCCTCTGCCGCCGACGGCAAGACGGGAGGGAGACCGTGA
 Primer design