SecReT4
Protein ID: 152985178
T4SS name [ID]Trb [327]
Gene symboltrbL
Locus tagPSPA7_3700
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]3835607..3836992 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA6V7L9
KEGG IDpap:PSPA7_3700
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-47, Aligned region: 37..264
Protein Sequence: 461 a.a.     [Download]
>gi|152985178|ref|YP_001349054.1| conjugal transfer protein TrbL [Pseudomonas aeruginosa PA7]
MNDVTIIDQFLNTFAAYIESGFGLLRGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIINNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGIDSGAPILEQIGEMAGFPEVF
VNLDPIVVMFLAWLVVVLCFFALAIQLFITLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVASGVK
VLVLAVIVGIGSGLFAQFQVHPAEPSIDHALVIMLASLTLLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGAAGTAVAIGAAATGVGGAVAAGARMAPAAAKLAGSGARAATSAASSAKSAFQAGSAAAGGGAKGAMAG
LGNVAKTGAQAAGRGAASRASAAGQRMAAPFRAGWNGTAADGGAGAASGQGAAGEAASGAATAQTQEQPA
WAKRLHRRQQLTHAATTTAHALRGGDGGGSGQGPSLRDSDS
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3836992-3835607 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAATGACGTGACCATCATCGACCAATTCCTCAACACCTTTGCCGCTTATATCGAATCGGGTTTCGGGC
TGCTGCGGGGCGAAGTGGCCTTCCTCACTGCCACGCTGATCGTCATCGACATGACGATCGCCGGTCTGTA
TTGGGCCATGAGTCATGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCATCAATAACTTCAACTGGCTGGCCAGCATCGTGTTCCGCTCGTTTGCGG
GATTGGGCATCACCGCCACCGGCTCGGCCATCACGATGGAGAACTTCTTGCAGCCGGGCCGGCTGGCGAA
AACCGGCATCGACTCCGGGGCGCCGATTCTGGAGCAGATCGGCGAGATGGCGGGCTTTCCCGAAGTGTTC
GTGAACCTCGACCCCATCGTGGTGATGTTCCTCGCATGGCTGGTCGTGGTCTTGTGCTTCTTCGCCCTGG
CGATCCAACTGTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCCGGATTCGTGCTGGTGCCATT
CGCGCTCTGGAACAAGACCGCGTTCCTCGCCGAAAAGGTTTTGGGCAACGTGGTGGCCTCCGGCGTCAAG
GTTCTGGTGCTGGCCGTGATCGTCGGTATCGGCTCGGGCTTGTTCGCTCAGTTCCAAGTCCATCCCGCCG
AGCCGTCTATCGACCACGCGCTGGTCATCATGCTGGCCTCGCTCACCTTGCTGGCGCTCGGGATCTTCGG
CCCCGGCATCGCCACGGGCCTCGTCTCCGGTGCGCCGCAGCTCGGCGCTGGCGCAATGGCCGGTGCTGCT
GTCGGCGCTGCCGGCACGGCCGTCGCCATCGGCGCCGCCGCGACGGGCGTGGGTGGCGCCGTGGCTGCTG
GTGCGCGCATGGCCCCGGCTGCCGCCAAGCTGGCCGGTAGCGGTGCGCGCGCCGCCACGTCGGCGGCCAG
CAGTGCGAAGTCGGCGTTCCAGGCCGGTTCCGCCGCCGCTGGCGGCGGCGCAAAGGGTGCGATGGCGGGC
CTGGGCAACGTCGCCAAGACCGGCGCGCAGGCAGCCGGGCGAGGCGCTGCATCCCGCGCTTCCGCTGCCG
GGCAACGCATGGCCGCTCCCTTCCGCGCTGGCTGGAATGGCACTGCTGCCGATGGCGGCGCGGGGGCGGC
ATCCGGTCAGGGTGCCGCAGGCGAGGCCGCATCCGGCGCCGCTACGGCGCAGACACAGGAACAGCCCGCT
TGGGCCAAGCGCCTGCATCGCCGCCAGCAACTCACCCACGCCGCGACCACCACCGCCCACGCACTGCGCG
GTGGCGATGGCGGCGGCTCCGGCCAGGGGCCGAGCCTGCGCGATTCCGATTCATAA
 Primer design