SecReT4
Protein ID: 152985574
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4515
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4641301..4644252 [+]
Producttype IV secretory pathway, VirB4 component
Component typeTfc16
UniProt IDA6V9Y0
KEGG IDpap:PSPA7_4515
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.9e-67, Aligned region: 75..351
AAA_10 [PF12846], Evalue: 5.1e-43, Aligned region: 546..886
FtsK_SpoIIIE [PF01580], Evalue: 4.1e-05, Aligned region: 542..576
Protein Sequence: 983 a.a.     [Download]
>gi|152985574|ref|YP_001349865.1| type IV secretory pathway, VirB4 component [Pseudomonas aeruginosa PA7]
MELLQFFRRRAQGHDAAIQEGQNTAPQEAKVQDALREEATERYLARLAAMGIPLPNTGSKNGATQAEASR
LYDHDPSFVDLLPWAEYLPDEQVMLLEDGRSRAVFFELVPLGTEGRDPNWMQNARDALKEALQNSFDEHE
TSPWIVQFYAQDEISWDNFQEQLRQYVHPRARGSAFSEMYLALMKHHLEGISKPGGLFVDTAVSKLPWRG
QQRRVRMVVYRRIRKADAQIRGQDPTAYLKSICERIQGGLANAGIVASRMSGQDVRNWLIRWFNPHPDHL
GKTDADLRRFYELVCRPDEPILQDELPLADGTDFSQNLFYRQPVSDATQGVWLFDAMPHRVIVVDQLNKA
PLTGHFTGETLKGDGLNALFDRMPEDTLLCITMVVTPQDMLEGHLQQLSKKAVGDTQASIHTREDVATVR
RLIGREHKLYRGSIALFVRGRDHTQLEERCITLSNVLLGAGLVPVEPQNEVGPLNSYLRWLPCNFDPNEK
RALEWYTQMMFAQHIANLSPIWGRTTGTGHPGFTLFNRGGAPLTFDPFNKLDRQMNAHGFIFGPTGSGKS
ASLTNLISQMLAMYLPRMFVAEAGNSFGLLADFAKRFGLSVHRVRLAPGSGVSLAPYADAIKLVESPDQV
KVLDAEDIEASDSVQGSKADLEDDQRDILGEMEIVARLMITGGEEKEDARLTRADRSAIRQAILAAARTC
AAANRTVLTQDVRDALYQASRSDGSAPERRARLAEMAEAMQMFCMGADGEMFNREGTPWPEADLTVVDFA
TYAREGYAAQLGIAYISLLNTVNNIAERDQFKGRPIVKITDEGHIITKHPLLLPYAMKITKMWRKLGAWF
WLATQNIDDIPASGAPMLNMIEWWLCLNMPPDEVEKISRFRELSPAQKSMMLSARKESGKFTEGVLLAKG
KEYLFRVVPPSLYLALAMTENEEKNQRYNIMQATGCDELEAALQVAADLDKARGLPPFPIIFPDQPAVEC
QDE
 
Nucleotide Sequence: 2952 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4641301-4644252 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGAATTGCTTCAATTTTTTCGCCGCCGCGCCCAAGGACATGACGCGGCTATTCAGGAAGGGCAGAACA
CCGCTCCACAAGAAGCCAAAGTCCAAGACGCACTACGGGAAGAAGCCACCGAGCGCTATCTGGCGCGACT
GGCCGCCATGGGTATTCCTCTGCCCAACACCGGGAGCAAGAATGGCGCCACGCAGGCTGAAGCGTCACGC
CTCTACGATCACGACCCATCGTTCGTCGACCTGCTGCCCTGGGCTGAGTACCTGCCCGACGAACAGGTGA
TGCTCCTGGAAGATGGGCGTTCGCGTGCCGTCTTCTTCGAGCTGGTGCCCTTGGGCACCGAGGGCCGCGA
CCCCAATTGGATGCAGAACGCCCGGGACGCATTGAAAGAAGCCCTGCAGAACTCCTTCGACGAGCACGAA
ACCTCGCCCTGGATCGTCCAGTTCTACGCCCAGGACGAGATCAGCTGGGACAATTTCCAGGAGCAGTTGA
GGCAGTACGTCCATCCTCGAGCGCGAGGATCGGCCTTCAGCGAGATGTACCTGGCGCTCATGAAGCATCA
CCTGGAGGGCATTTCGAAGCCGGGCGGACTGTTCGTCGACACCGCCGTCAGCAAGCTGCCCTGGCGAGGA
CAACAGCGGCGCGTGCGGATGGTCGTCTACCGCCGGATCCGCAAGGCGGATGCGCAGATTCGCGGACAGG
ACCCGACGGCATATCTGAAATCCATCTGCGAGCGTATCCAAGGCGGCCTGGCGAACGCCGGCATCGTCGC
TTCGCGCATGAGCGGCCAGGACGTCAGGAACTGGTTGATTCGCTGGTTCAACCCGCACCCGGATCACCTC
GGCAAGACCGATGCGGATCTACGTCGCTTCTACGAACTGGTATGCCGGCCGGACGAACCGATCCTGCAGG
ACGAGTTGCCGCTGGCCGACGGCACCGACTTCTCCCAGAACCTGTTCTATCGGCAGCCTGTTTCCGATGC
CACCCAGGGCGTATGGCTCTTCGATGCCATGCCGCACCGTGTGATCGTGGTCGACCAGTTGAACAAGGCG
CCGCTGACAGGCCACTTCACTGGCGAGACGCTCAAAGGCGATGGCCTGAACGCCCTGTTCGATCGCATGC
CCGAGGACACGCTGCTGTGTATCACCATGGTGGTGACGCCGCAGGACATGCTGGAAGGGCATCTGCAGCA
GCTCTCGAAAAAGGCCGTTGGTGACACCCAGGCCTCGATCCACACCCGCGAGGACGTGGCCACCGTTCGC
CGCCTGATCGGCCGGGAGCACAAGCTCTATCGCGGTTCGATCGCTCTGTTCGTGCGCGGCCGCGACCATA
CCCAGCTGGAGGAGCGCTGCATCACCCTGAGCAACGTGCTGCTCGGCGCCGGCCTTGTGCCGGTCGAACC
GCAGAACGAAGTCGGACCGCTGAACAGCTACCTGCGCTGGCTGCCCTGCAATTTCGATCCGAACGAGAAG
CGAGCCCTGGAGTGGTACACCCAGATGATGTTCGCGCAGCACATCGCCAACCTGTCGCCCATCTGGGGGC
GCACCACCGGTACCGGGCACCCTGGCTTCACGCTGTTCAACCGTGGCGGTGCGCCGTTGACCTTCGACCC
GTTCAACAAGCTGGACCGGCAGATGAATGCCCACGGCTTCATCTTCGGGCCAACCGGGTCCGGCAAGTCA
GCGTCCCTGACCAACCTCATCAGCCAGATGCTCGCCATGTACCTGCCACGGATGTTCGTCGCGGAAGCGG
GCAACAGTTTCGGCCTGCTGGCCGACTTCGCCAAGCGGTTTGGCCTCTCGGTCCACCGGGTCCGCCTCGC
CCCGGGCTCCGGGGTCAGCCTGGCGCCGTACGCGGACGCCATCAAGCTGGTCGAGAGTCCCGACCAGGTG
AAGGTCCTGGATGCCGAAGACATCGAGGCCTCGGACTCGGTCCAGGGCAGCAAGGCCGACCTCGAGGACG
ACCAGCGAGACATCCTGGGCGAGATGGAGATCGTCGCCCGCCTGATGATCACCGGCGGCGAGGAAAAGGA
AGACGCGCGCCTGACCCGTGCCGATCGCAGCGCCATCCGCCAGGCGATTCTGGCGGCGGCCAGGACCTGC
GCCGCCGCGAACCGCACGGTGCTGACCCAGGATGTGCGCGATGCGCTCTACCAGGCCTCCAGGAGCGATG
GCTCCGCGCCAGAACGCCGCGCGCGCCTGGCCGAAATGGCGGAAGCCATGCAGATGTTCTGCATGGGTGC
CGACGGCGAGATGTTCAATCGCGAAGGCACGCCCTGGCCTGAAGCCGACCTCACCGTGGTGGATTTCGCG
ACTTACGCGCGCGAAGGCTACGCCGCCCAGCTCGGGATCGCCTACATCTCGCTGCTGAACACCGTGAACA
ACATCGCCGAACGCGACCAGTTCAAGGGCCGGCCCATCGTCAAGATCACCGATGAGGGGCACATCATCAC
CAAGCACCCGCTGCTGCTGCCCTACGCCATGAAGATCACCAAGATGTGGCGGAAACTGGGCGCCTGGTTC
TGGCTCGCCACCCAGAACATCGACGACATCCCAGCCTCCGGGGCGCCGATGCTTAACATGATCGAGTGGT
GGCTGTGCCTGAACATGCCCCCCGACGAGGTAGAGAAGATCTCCAGGTTCCGCGAGCTGTCGCCGGCGCA
GAAGTCGATGATGCTCTCGGCCCGCAAGGAAAGCGGCAAATTCACCGAGGGCGTGCTCCTGGCCAAGGGC
AAGGAGTACCTCTTCCGTGTGGTTCCCCCGAGTCTCTACTTAGCCCTGGCCATGACCGAAAACGAAGAAA
AGAACCAGCGCTACAACATCATGCAAGCCACCGGCTGCGACGAGCTCGAGGCGGCCTTGCAGGTCGCAGC
GGATCTCGACAAGGCGCGCGGCCTGCCACCCTTCCCCATTATTTTCCCAGACCAACCGGCAGTGGAGTGC
CAGGACGAATGA
 Primer design