SecReT4
Protein ID: 152986494
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4502
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4631370..4632116 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA6V9W7
KEGG IDpap:PSPA7_4502
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7.7e-70, Aligned region: 46..245
Protein Sequence: 248 a.a.     [Download]
>gi|152986494|ref|YP_001349852.1| hypothetical protein PSPA7_4502 [Pseudomonas aeruginosa PA7]
MAEVTQRAEQQQESQKTLVGTIISTPFQFLGVMFGSLVGAIIVEWVCLYFFWPDAGWKHAQAMFEYELSW
LSQGLLHSVVVQEPGRTATWLAQLAYDWLFVKTGIVDWMTNMTTIAQAGPRSPLDVRYLTAQGVSTLQNY
GLAALYTVLTFVVRLVILVMTIPLFLMAAFTGLVDGLVRRDLRKFGAGRESSYLYHKARGSIIPLAVVPW
TLYLAIPISINPLLILLPCAALLGVAVCITASTFKKYL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4631370-4632116 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGCTGAAGTCACTCAACGTGCAGAGCAGCAACAAGAGAGCCAGAAGACCCTTGTCGGCACCATCATCA
GTACGCCCTTCCAATTTCTCGGCGTGATGTTCGGTTCGCTGGTCGGCGCAATCATCGTGGAGTGGGTTTG
CCTGTATTTCTTCTGGCCTGACGCGGGCTGGAAGCATGCCCAGGCCATGTTCGAGTACGAACTCAGTTGG
CTGTCGCAGGGGCTGCTACACAGCGTCGTCGTGCAGGAGCCAGGTCGAACCGCCACCTGGCTGGCCCAGT
TGGCCTATGACTGGTTGTTCGTGAAGACCGGGATAGTCGACTGGATGACCAACATGACCACCATCGCGCA
GGCAGGGCCACGGAGCCCTCTGGACGTTCGCTATCTCACCGCCCAGGGTGTCTCCACGCTGCAGAACTAC
GGCCTGGCCGCGCTGTACACGGTGCTGACATTCGTCGTGCGCCTGGTGATTCTGGTCATGACGATCCCGT
TGTTCCTGATGGCCGCGTTCACCGGCCTGGTGGACGGCCTGGTGCGCCGGGACCTGCGCAAGTTCGGCGC
CGGCCGGGAGTCCAGCTACCTCTACCACAAGGCGCGCGGCAGCATCATTCCGCTAGCGGTCGTCCCTTGG
ACCCTCTACCTGGCGATCCCCATCAGCATCAACCCCTTGCTCATCCTGCTGCCCTGCGCCGCGCTGCTCG
GCGTAGCGGTGTGCATCACAGCATCCACCTTCAAGAAATACCTCTAG
 Primer design