SecReT4
Protein ID: 152987276
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4511
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4637851..4638510 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDA6V9X6
KEGG IDpap:PSPA7_4511
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.9e-86, Aligned region: 4..204
Protein Sequence: 219 a.a.     [Download]
>gi|152987276|ref|YP_001349861.1| hypothetical protein PSPA7_4511 [Pseudomonas aeruginosa PA7]
MSFRKHTAQQQAHINTFRFITGFLCMVIVVLAYCVWEARKDLWIHIPPDLRSGSTRLWWDIPPESVYAFG
LYIFQQVQRWPKDGEVDYKGNLFRYAAYLTPSCKVFLEKDFEFRRNAGELRGRERTTSEIPGRGIGESDG
RVIQHSINDWTVNLDMDSTEYYAGEKIKRALARYPLHVIRADVDPETNPFGLQWDCYSDTPQRIELEEPA
APTKREGGL
 
Nucleotide Sequence: 660 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4637851-4638510 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAGTTTCAGAAAACACACCGCGCAACAGCAGGCTCACATCAACACGTTCCGGTTCATCACCGGCTTCT
TGTGCATGGTCATCGTGGTGCTGGCCTACTGCGTCTGGGAAGCCCGCAAGGACCTCTGGATCCACATTCC
GCCCGACTTGCGTTCAGGGAGCACCCGGTTGTGGTGGGACATTCCGCCGGAGAGTGTCTATGCATTCGGC
CTCTACATCTTCCAGCAGGTACAGCGTTGGCCCAAGGACGGCGAGGTGGACTACAAGGGAAACCTGTTCC
GCTACGCCGCCTACCTCACTCCCTCCTGCAAAGTCTTCCTGGAGAAAGACTTCGAGTTTCGTCGTAACGC
CGGCGAGCTCAGGGGGCGCGAGCGCACCACCTCGGAAATCCCCGGTCGGGGCATTGGCGAGAGCGATGGC
CGCGTGATCCAGCACTCGATCAATGACTGGACCGTCAACCTGGACATGGACAGCACGGAGTATTACGCCG
GCGAGAAGATCAAGCGGGCGCTGGCCCGCTACCCGTTGCACGTCATCCGCGCCGACGTCGACCCGGAGAC
CAATCCCTTCGGCCTGCAGTGGGACTGCTACTCCGACACGCCTCAACGTATCGAACTCGAGGAGCCGGCC
GCCCCCACCAAGCGGGAGGGAGGTCTATGA
 Primer design