SecReT4
Protein ID: 152987382
T4SS name [ID]Trb [327]
Gene symbol-
Locus tagPSPA7_3705
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]3840782..3841165 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA6V7M4
KEGG IDpap:PSPA7_3705
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.8e-24, Aligned region: 32..117
Protein Sequence: 127 a.a.     [Download]
>gi|152987382|ref|YP_001349059.1| conjugal transfer protein TrbC [Pseudomonas aeruginosa PA7]
MTQMTIPAFRFSANPALRLARLRCLARPAGQGLLLAALLLFLAGTAQAAGSSMPWEGPLQSILESIQGPV
ARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c3841165-3840782 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGACGCAGATGACCATTCCTGCTTTCCGTTTTTCTGCAAATCCGGCTTTGCGTCTTGCGCGGCTGCGTT
GCCTGGCCCGTCCTGCGGGGCAAGGGCTGCTGCTGGCCGCGCTGCTGTTGTTCCTGGCCGGAACCGCGCA
GGCCGCAGGTTCCTCGATGCCGTGGGAAGGCCCGCTGCAATCCATCCTCGAATCCATCCAGGGGCCGGTG
GCGCGCATCGTCGCGGTCATCATCATCATTGCCACGGGCCTCGCGCTCGCGTTCGGCGACACGTCCGGCG
GGTTCCGCAAACTGATCCAGATCGTCTTCGGTCTGTCCATCGCCTTCGCGGCTTCCAGCTTCTTCCTGTC
GTTCTTCAGCTTCTCCGGCGGGGCCGTCGTATGA
 Primer design