SecReT4
Protein ID: 152987561
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4512
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4638507..4639391 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDA6V9X7
KEGG IDpap:PSPA7_4512
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.4e-124, Aligned region: 5..287
Protein Sequence: 294 a.a.     [Download]
>gi|152987561|ref|YP_001349862.1| hypothetical protein PSPA7_4512 [Pseudomonas aeruginosa PA7]
MIRKSTGSLLLMLALPTLAHAVEILRWERIPLAIPLTVGQERIVFVDRNVRVGVPRDLQGKLRVQSTGGA
LYLLANEPIPPARLRLQDATNGEQMLIDIAASEAAADQQPREPVRIVAGEPVAPHYGQPREAQPSAAAKQ
TAQAEAPKAVPRETPVPVVLTRYAAQMLYAPLRTVEPVDGVGQVRVKRQLDLNTLLPSLPITATALGAWR
LDDYYVTAVKLQNASAQHLALDPRDLMGNFIAATFQHPYLGPRGDASDTTTVYLVTRGRGLADALLPSAI
SQIDPKGGRRGADR
 
Nucleotide Sequence: 885 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4638507-4639391 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGATCCGGAAGTCGACAGGCTCGCTCTTGCTAATGCTTGCCCTACCCACACTGGCCCACGCGGTGGAGA
TTCTGCGCTGGGAGCGCATTCCGTTGGCCATTCCATTGACGGTCGGCCAGGAACGCATTGTCTTTGTCGA
CAGAAACGTGCGAGTTGGCGTTCCTCGGGATCTGCAGGGCAAGCTGCGCGTCCAGAGTACCGGCGGCGCA
CTCTACCTGCTCGCCAACGAGCCGATTCCTCCAGCGCGCCTGCGCCTGCAGGACGCGACCAATGGCGAGC
AGATGCTCATCGATATCGCCGCCTCCGAGGCAGCGGCCGATCAACAGCCGCGCGAGCCGGTCAGGATCGT
CGCCGGCGAGCCCGTGGCTCCGCACTATGGCCAGCCCCGGGAAGCCCAGCCATCGGCAGCAGCGAAACAG
ACCGCGCAGGCAGAAGCACCGAAGGCCGTGCCGCGCGAAACGCCCGTCCCCGTGGTTCTGACGCGCTATG
CGGCGCAGATGCTCTATGCCCCACTTCGCACGGTGGAACCGGTGGATGGAGTCGGTCAGGTGCGCGTCAA
GCGACAGCTCGACCTGAATACCCTGCTCCCCAGTCTGCCCATCACGGCTACCGCCTTGGGCGCCTGGCGG
CTGGACGACTACTACGTCACGGCGGTGAAGCTGCAGAACGCCAGCGCCCAGCACCTGGCCCTGGATCCCA
GGGACCTGATGGGCAATTTCATCGCCGCAACCTTCCAGCACCCGTACTTGGGACCCCGGGGCGACGCTTC
CGACACCACCACCGTGTATCTGGTGACGCGCGGCCGCGGCCTTGCCGACGCGCTCCTGCCCTCCGCCATC
AGCCAGATCGATCCCAAAGGAGGCCGTCGTGGCGCTGACCGGTAA
 Primer design