SecReT4
Protein ID: 152987722
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4499
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4628357..4628857 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDA6V9W4
KEGG IDpap:PSPA7_4499
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 3.2e-48, Aligned region: 26..164
Protein Sequence: 166 a.a.     [Download]
>gi|152987722|ref|YP_001349849.1| hypothetical protein PSPA7_4499 [Pseudomonas aeruginosa PA7]
MKKILATLAFCTAFATQAWAAGLIVVEDLGGASALPYYQGLDPQPSAATPGPGDLGVRGSGAFPVRSVRL
SPGQVQGRAINAPGLQPLFLVGDDTLSRTWLKERGDELRGLQAVGLAVNVASEARLTEIRAWGKGLQILP
APADDLVDRLGLRHYPALITSTAIQQ
 
Nucleotide Sequence: 501 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4628357-4628857 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAAGAAGATCCTTGCCACGCTGGCATTTTGCACGGCGTTCGCGACTCAAGCCTGGGCCGCCGGGCTGA
TCGTTGTCGAAGACCTCGGCGGCGCCTCGGCGCTCCCCTACTACCAGGGCCTGGATCCGCAGCCATCCGC
TGCCACACCAGGACCTGGCGACCTGGGTGTCCGTGGCTCAGGTGCGTTTCCAGTTCGCTCGGTACGCCTT
TCGCCAGGCCAGGTTCAGGGGCGCGCCATCAACGCCCCAGGCCTGCAACCTCTGTTCCTGGTCGGCGACG
ACACGCTGTCTCGAACCTGGCTGAAAGAGCGAGGCGACGAGCTCCGAGGCCTCCAAGCCGTGGGCCTGGC
AGTGAACGTGGCCAGCGAAGCGCGTCTGACGGAAATCCGTGCCTGGGGAAAAGGACTTCAGATATTGCCG
GCGCCGGCGGACGACCTGGTCGACCGGCTAGGTCTGCGGCACTACCCCGCTCTCATCACATCCACCGCCA
TCCAGCAGTAG
 Primer design