SecReT4
Protein ID: 152988450
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4507
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4636509..4636847 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA6V9X2
KEGG IDpap:PSPA7_4507
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.5e-32, Aligned region: 26..104
Protein Sequence: 112 a.a.     [Download]
>gi|152988450|ref|YP_001349857.1| hypothetical protein PSPA7_4507 [Pseudomonas aeruginosa PA7]
MNTPHQPLRRTCLAVLACGALVAQGAFAASASEQANLAVMIRQLNALEDTARRSAQGADEPGQRFYFDYS
RLAADLQRIRQGLQDYMTPSRAQPRDPSDLSGNYTLRGGPMP
 
Nucleotide Sequence: 339 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4636509-4636847 Pseudomonas aeruginosa PA7 chromosome, complete genome
GTGAACACTCCACATCAACCCCTTCGCCGAACCTGCCTGGCCGTATTGGCCTGCGGTGCGCTGGTCGCAC
AGGGAGCCTTCGCAGCGAGCGCCTCCGAGCAGGCGAACCTGGCGGTGATGATCCGGCAGCTCAATGCCCT
TGAGGACACCGCCCGCCGCAGTGCCCAGGGCGCCGATGAGCCCGGACAGCGCTTCTACTTCGACTACTCG
CGCCTGGCCGCTGACCTGCAGCGCATCCGCCAAGGCCTGCAGGACTACATGACCCCCAGCCGCGCCCAAC
CGCGTGACCCTTCAGACCTATCTGGGAATTACACCCTGCGCGGAGGGCCGATGCCGTGA
 Primer design