SecReT4
Protein ID: 152988871
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4497
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4627042..4627794 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDA6V9W2
KEGG IDpap:PSPA7_4497
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 250 a.a.     [Download]
>gi|152988871|ref|YP_001349847.1| hypothetical protein PSPA7_4497 [Pseudomonas aeruginosa PA7]
MNRTVSLLSGLVLLSYPAVGQEAAASRETSSQLSGSQLGTLKQQTSQSDLAQEWGLNQQEWTRYQTLMQG
PRGVYSPGIDPLTALGIEARSAEERRRYADLQVQAERRRVEKELAYQRAYDEAFARAYPGEGVIRLTESS
TANPSGTPNMSPALQSSGRLALFVQDNCTACIQRVRDLQQQNKEFDLYFVGSQNDAERVRHWAILAGVDP
KKVRSKQITLNHDEGRWMALGLGGALPALVQEVNGRWQRL
 
Nucleotide Sequence: 753 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4627042-4627794 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAACAGAACCGTATCGCTCCTGTCCGGCCTGGTGCTGCTGAGTTATCCCGCAGTCGGTCAGGAGGCTG
CGGCAAGCCGAGAGACCAGCAGCCAGCTGTCCGGTAGCCAACTCGGCACGCTGAAACAGCAGACATCTCA
GAGCGACCTGGCCCAGGAGTGGGGACTGAACCAACAGGAATGGACCCGCTACCAGACGCTCATGCAAGGC
CCCAGGGGCGTGTACTCGCCTGGCATTGACCCGCTGACTGCGCTGGGCATCGAGGCGCGATCGGCAGAGG
AACGGCGGCGGTATGCCGATCTACAGGTCCAGGCCGAACGGCGCCGGGTCGAGAAGGAACTCGCCTACCA
GCGCGCATACGACGAAGCCTTCGCCCGCGCCTATCCAGGCGAGGGGGTGATCCGCCTCACCGAAAGCAGC
ACGGCCAACCCGTCGGGCACCCCGAACATGAGCCCAGCGTTGCAGAGCAGCGGGCGCCTGGCCCTGTTCG
TCCAGGACAATTGCACCGCCTGCATCCAGCGGGTCCGCGACCTGCAGCAGCAGAACAAGGAGTTCGACCT
CTACTTCGTCGGTAGCCAGAACGACGCAGAGCGAGTGCGGCATTGGGCAATCCTCGCCGGCGTCGACCCG
AAGAAGGTTCGCAGCAAGCAGATCACGCTCAATCATGACGAGGGCCGCTGGATGGCCCTGGGACTGGGCG
GGGCCCTTCCCGCCCTGGTCCAGGAGGTGAACGGCCGATGGCAACGTCTGTAA
 Primer design