SecReT4
Protein ID: 152989206
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4498
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4627779..4628360 [+]
Productsoluble lytic murein transglycosylase
Component typeTfc4
UniProt IDA6V9W3
KEGG IDpap:PSPA7_4498
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 193 a.a.     [Download]
>gi|152989206|ref|YP_001349848.1| soluble lytic murein transglycosylase [Pseudomonas aeruginosa PA7]
MATSVIRALQLAALLVLANIAQAAVDPPPAYKQIALPKGVPAEVLYSVALTESKVLLRGEYVPWPWTLNV
AGKSYYYATRTAACTALLAAINLYGAKSVDSGLGQVNIGWNGHRFSSPCESLDPYKNLDATSDILIEQRD
ALYASAPGRPVDWIQVAGRYHRPAGGAPAAKYRRTVSRHLSQVLGVNLLVTNP
 
Nucleotide Sequence: 582 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4627779-4628360 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGGCAACGTCTGTAATCCGCGCCCTCCAACTGGCCGCCCTGCTGGTCCTGGCCAACATCGCTCAGGCCG
CCGTGGATCCACCGCCGGCGTATAAGCAGATCGCCCTGCCCAAAGGGGTTCCGGCCGAGGTGCTCTACTC
GGTCGCGCTGACCGAGAGCAAGGTCCTGCTGCGCGGCGAATACGTTCCCTGGCCTTGGACATTGAACGTC
GCCGGGAAATCCTACTACTACGCGACCCGCACCGCCGCCTGCACCGCGCTACTCGCGGCGATCAACCTCT
ACGGGGCCAAGAGCGTCGATTCCGGCCTCGGCCAGGTCAACATCGGCTGGAACGGACATCGTTTCTCCAG
CCCCTGCGAGTCCCTGGATCCGTACAAGAACCTGGACGCCACCTCCGACATCCTGATCGAGCAGCGGGAC
GCCCTGTATGCATCCGCCCCGGGAAGACCGGTGGACTGGATCCAAGTTGCCGGCCGCTACCACCGCCCCG
CCGGCGGCGCGCCTGCCGCCAAATACCGTAGGACGGTATCCCGCCACCTTAGCCAAGTCCTCGGCGTCAA
CCTACTGGTGACCAATCCATGA
 Primer design