SecReT4
Protein ID: 152989739
T4SS name [ID]Tfc [745]
Gene symbol-
Locus tagPSPA7_4510
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T4SS(s) in this replicon]
Location [Strand]4637468..4637854 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA6V9X5
KEGG IDpap:PSPA7_4510
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.1e-43, Aligned region: 9..125
Protein Sequence: 128 a.a.     [Download]
>gi|152989739|ref|YP_001349860.1| hypothetical protein PSPA7_4510 [Pseudomonas aeruginosa PA7]
MPEEHLFQDGTLSFLPTRLNRQPVVIGGLTADEMWITVFTSGAAGFALGIPAALVVGNAACIPLGALLVG
ALGLGIGSRVLRRMKRGRPDTWFYRQVELALSLRFPVFGNRHLVTRSGAWTSRRTESP
 
Nucleotide Sequence: 387 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4637468-4637854 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGCCCGAAGAACATCTGTTTCAGGATGGGACCCTCAGCTTCCTGCCGACCCGTTTGAACCGGCAACCGG
TGGTCATCGGCGGCCTGACCGCAGACGAAATGTGGATCACGGTCTTCACCAGCGGAGCAGCCGGGTTCGC
TCTTGGCATTCCAGCTGCCTTGGTCGTAGGTAACGCTGCCTGCATTCCACTGGGCGCGCTGCTGGTTGGC
GCCCTCGGCCTGGGTATCGGCAGCCGCGTCCTGCGGCGGATGAAGCGGGGGCGGCCTGACACCTGGTTCT
ATCGCCAGGTGGAGCTGGCCCTCTCGCTGCGCTTTCCCGTCTTCGGCAACCGTCACCTGGTGACGCGCTC
CGGCGCCTGGACCAGTCGACGCACGGAGTCCCCATGA
 Primer design