SecReT4
Protein ID: 152998533
T4SS name [ID]Tra_F [512]
Gene symbol-
Locus tagShew185_4436
StrainShewanella baltica OS185
Repliconplasmid pS18501 [GenBank: NC_009661] [Browse all T4SS(s) in this replicon]
Location [Strand]56110..56985 [-]
ProductType-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDA6WUQ7
KEGG IDsbm:Shew185_4436
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.5e-68, Aligned region: 63..281
Protein Sequence: 291 a.a.     [Download]
>gi|152998533|ref|YP_001355454.1| Type-F conjugative transfer system pilin assembly protein TraF [Shewanella baltica OS185]
MRTLLNDRLQHAAVSPFFRWSSHAPLAWLSTKKGDAVVNKRSALVLLMLTTFCLGANATDAQGWRWYNEP
TAPKKQALKKAETPSVTLTRTQTLTPTEQMDWFHSYYQDTLNDAAINSQDSKKVERAMLLNQYVSNKSSE
FGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKMRAVRSLADAGWGLFFVYKGQEEIDIALAPS
VQQFATEHGIELLGVTLDGVALPAIVQNRQNDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRF
LNVATDFAPDF
 
Nucleotide Sequence: 876 bp     [Download]
>gi|152998483|ref|NC_009661.1|:c56985-56110 Shewanella baltica OS185 plasmid pS18501, complete sequence
ATGAGGACGTTGTTAAATGACCGCTTACAACATGCCGCAGTATCTCCTTTTTTTCGGTGGTCAAGCCACG
CGCCGTTGGCGTGGTTGTCCACAAAAAAAGGGGATGCGGTGGTCAACAAGCGCAGCGCGTTAGTGCTCCT
TATGCTGACAACGTTTTGCCTCGGCGCAAACGCAACGGATGCACAAGGCTGGCGCTGGTATAACGAACCG
ACCGCCCCCAAGAAGCAAGCACTTAAAAAGGCCGAAACGCCAAGCGTCACACTTACCCGAACGCAAACGC
TGACCCCGACAGAGCAGATGGATTGGTTTCACAGCTACTACCAAGACACGCTCAATGACGCGGCGATAAA
CAGCCAAGACAGCAAGAAAGTGGAAAGGGCAATGCTGCTTAATCAGTACGTCAGCAATAAATCCTCAGAG
TTCGGCATGACCTTTAAAAAGGTCCTGCTAGATAACCCTGAGCTGTCTTACACCAAAGATAGACCGACGG
AACAAGCGGCAAGAAGCACCTATTTATCATTAGAGCGCAACAAGAAGATGCGCGCAGTACGCAGCCTTGC
CGATGCGGGATGGGGGCTGTTCTTTGTCTACAAAGGCCAAGAAGAAATTGATATTGCGCTAGCGCCCAGC
GTGCAGCAGTTCGCTACTGAGCATGGCATTGAGCTACTGGGCGTCACGCTCGATGGTGTAGCACTGCCAG
CCATCGTGCAGAACCGCCAAAACGACCAGCACATAAACGTCCCGTTTAGTCCCGCACTCGTGTTAGTTAA
TCCTGGCACGGGGGAAATGAAACCGCTCGCGTATGGCTTTATCTCTCAAGACGATTTACTGGGCCGCTTC
CTGAACGTGGCCACCGATTTCGCCCCTGACTTTTAA
 Primer design