SecReT4
Protein ID: 152998544
T4SS name [ID]Tra_F [512]
Gene symbol-
Locus tagShew185_4447
StrainShewanella baltica OS185
Repliconplasmid pS18501 [GenBank: NC_009661] [Browse all T4SS(s) in this replicon]
Location [Strand]67643..67945 [-]
ProductType IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDA6WUR8
KEGG IDsbm:Shew185_4447
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.1e-33, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|152998544|ref|YP_001355465.1| Type IV conjugative transfer system protein TraL [Shewanella baltica OS185]
MDNPTQFFSIPKHLNNTPTLLGFAMDELVPALVFFAVLFMMNHALIGMVLASSWFLGMRRMKSQYGMCVL
RLTAYWYAPAEFSASFLRRTPAACRRYWLR
 
Nucleotide Sequence: 303 bp     [Download]
>gi|152998483|ref|NC_009661.1|:c67945-67643 Shewanella baltica OS185 plasmid pS18501, complete sequence
GTGGATAACCCCACTCAGTTTTTTAGCATCCCTAAACACCTCAACAACACCCCTACGCTATTAGGGTTCG
CGATGGATGAACTTGTCCCAGCCTTAGTTTTTTTTGCCGTGTTATTCATGATGAATCACGCGCTCATTGG
CATGGTACTAGCCTCTTCATGGTTTTTAGGGATGCGCAGAATGAAATCACAATACGGCATGTGCGTCTTA
CGCCTCACCGCCTATTGGTATGCCCCTGCAGAATTTAGCGCATCATTTTTAAGACGAACGCCTGCGGCCT
GTCGCCGCTACTGGTTACGTTAA
 Primer design