SecReT4
Protein ID: 153007989
T4SS name [ID]VirB [220]
Gene symbol-
Locus tagOant_0647
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 1 [GenBank: NC_009667] [Browse all T4SS(s) in this replicon]
Location [Strand]674591..676504 [-]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDA6WWM1
KEGG IDoan:Oant_0647
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2e-94, Aligned region: 166..634
TraG-D_C [PF12696], Evalue: 5.4e-30, Aligned region: 473..596
TrwB_AAD_bind [PF10412], Evalue: 8.3e-21, Aligned region: 392..612
Protein Sequence: 637 a.a.     [Download]
>gi|153007989|ref|YP_001369204.1| conjugal transfer coupling protein TraG [Ochrobactrum anthropi ATCC 49188]
MTTGAKPHPSQLLVLVPIAVSSLAFYIANWRWPELAAGLSGKPQYWVLRASPVPALICGPLAGLLTVWML
PLHQRKPIALASLACFLLITGFYALREITRLSPFVESRALSWDQALSYLDMIAVVSAVIGFIAAAVSARI
SSVVPAQIKRARRASFGDADWLPMRALARLFPEDGEIVVGERYRVDKELVHKLPFDPNDPATWGRGGKAP
LLTYKQDFDSTHMLFFAGSGGYKTTSNVVPTALRYIGPIICLDPSTEVAPMVIEHRRNKLQRDVMVLDPT
NPIMGFNVLDGIETSTKKEEDIVGIAHMLLSESVRFESSTGSFFQNQAHNLLTGLLAHVMLSPEFSGRRN
LRSLRQIVSEPETSVLAMLRDVQEHSGSTFIRETLGVFVNMTEQTFSGVYSTASKDTQWLSLDNYAALVC
GDSFKSAEIATGKKDVFLNIPASILRSYPGIGRVIIGSLINAMIEADGAFGRRALFMLDEVDLLGYMRVL
EEARDRGRKYGISMMLMYQSVGQLERHFGKDGALSWIDGCAFASYAAIKALDTARNVSAQCGEMTVEVKS
SSRNIGWDAKNSASRKSENLNLQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKEMDEAAE
VNRFVKR
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|153007346|ref|NC_009667.1|:c676504-674591 Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence
ATGACGACTGGCGCAAAACCGCATCCAAGCCAATTGCTCGTCCTGGTGCCAATCGCTGTTTCCAGTTTAG
CATTCTATATTGCCAACTGGCGTTGGCCGGAATTGGCCGCTGGCTTATCAGGGAAACCGCAATACTGGGT
TTTGCGAGCGTCTCCTGTACCAGCCCTTATATGCGGCCCACTTGCCGGGCTCCTGACTGTCTGGATGTTG
CCATTGCATCAGCGGAAACCAATCGCGCTGGCAAGTCTTGCCTGCTTCCTGCTGATAACTGGCTTCTACG
CATTGCGCGAAATTACCCGTCTTTCCCCCTTCGTGGAAAGCCGGGCATTGAGTTGGGACCAGGCGCTGTC
ATACCTTGATATGATCGCGGTCGTCAGCGCTGTCATTGGCTTTATTGCCGCGGCTGTATCAGCACGCATT
TCCAGTGTCGTGCCTGCACAGATAAAGCGGGCCCGGCGCGCAAGCTTCGGCGATGCAGACTGGCTGCCAA
TGCGGGCGCTAGCACGACTATTCCCGGAAGATGGCGAAATCGTCGTTGGCGAACGTTATCGCGTCGACAA
GGAGCTCGTTCATAAACTACCATTCGATCCAAATGACCCAGCCACATGGGGACGCGGCGGCAAGGCACCG
CTTCTTACCTACAAGCAGGATTTCGATTCAACGCATATGCTCTTCTTTGCCGGATCAGGCGGCTACAAGA
CGACGAGTAACGTCGTGCCGACAGCGCTGCGCTATATCGGCCCGATCATCTGCCTTGATCCCTCAACCGA
AGTCGCCCCGATGGTCATCGAACATCGCCGCAACAAACTTCAGCGCGACGTGATGGTGCTTGATCCAACC
AATCCGATCATGGGCTTCAACGTCCTTGACGGTATTGAGACCTCCACGAAGAAAGAGGAGGACATTGTTG
GAATAGCCCATATGCTTTTGTCGGAAAGCGTTCGCTTCGAAAGCTCTACCGGTTCGTTTTTCCAGAACCA
GGCGCACAATCTCCTGACCGGGCTCCTTGCCCATGTGATGTTGTCGCCGGAGTTTTCCGGACGGCGTAAT
CTACGTAGCCTGCGCCAGATCGTTTCGGAACCTGAAACGTCTGTGCTTGCCATGCTCCGTGACGTTCAGG
AACATTCTGGGTCCACCTTCATTCGCGAAACGCTCGGCGTTTTCGTCAATATGACCGAACAGACCTTCTC
CGGCGTCTATTCCACCGCCTCAAAAGATACCCAGTGGCTGTCACTGGACAATTACGCGGCGCTTGTCTGC
GGTGACAGTTTCAAATCCGCCGAAATCGCGACCGGCAAGAAGGACGTATTTCTGAATATCCCCGCATCGA
TCCTGCGTTCCTATCCGGGGATCGGGCGAGTGATCATCGGCTCCCTGATCAATGCAATGATCGAGGCCGA
TGGTGCATTTGGGCGCCGTGCCCTCTTCATGCTCGATGAGGTCGATCTGCTTGGCTACATGCGCGTGTTG
GAAGAAGCACGCGATCGCGGACGCAAATACGGCATCAGCATGATGTTGATGTACCAGTCCGTTGGCCAGC
TTGAACGACATTTCGGCAAAGACGGTGCCCTCTCATGGATCGATGGATGCGCCTTCGCAAGCTACGCCGC
GATCAAGGCGCTCGACACCGCTCGAAACGTCTCGGCGCAATGTGGTGAAATGACGGTGGAAGTGAAAAGC
AGTTCACGCAATATCGGCTGGGATGCAAAAAACAGCGCTTCGCGGAAATCTGAGAACCTGAATTTACAGC
GCCGCCCCCTGATCATGCCGCACGAAATTACTCAGTCGATGCGCAAAGACGAGCAGATCATCATTGTACA
GGGACACAGTCCAATCCGCTGTGGGCGCGCCATCTATTTCCGGCGAAAGGAAATGGACGAGGCTGCGGAA
GTCAACCGGTTCGTCAAACGATAA
 Primer design