SecReT4
Protein ID: 153008020
T4SS name [ID]VirB [220]
Gene symbol-
Locus tagOant_0681
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 1 [GenBank: NC_009667] [Browse all T4SS(s) in this replicon]
Location [Strand]707837..708148 [+]
Producthypothetical protein
Component typeVirB7
UniProt IDA6WWQ2
KEGG IDoan:Oant_0681
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 103 a.a.     [Download]
>gi|153008020|ref|YP_001369235.1| hypothetical protein Oant_0681 [Ochrobactrum anthropi ATCC 49188]
MSEGDLLMTSSAAMKNRYLSVIKPTLFLGIALALVSCASLTNPLPKCDGNARRPLNRAMWQWERSSAMPK
SKAESIPRFVDERKPSRAFDHLDIDASFGDCED
 
Nucleotide Sequence: 312 bp     [Download]
>gi|153007346|ref|NC_009667.1|:707837-708148 Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence
GTGAGCGAAGGAGACCTGCTTATGACCTCGTCTGCGGCGATGAAAAACAGGTATTTGTCAGTAATCAAAC
CGACCTTGTTTCTCGGGATCGCGCTCGCACTTGTCAGTTGTGCGTCGCTGACAAATCCCTTGCCGAAATG
CGATGGAAATGCGCGAAGACCACTGAACCGCGCAATGTGGCAATGGGAAAGATCGAGTGCAATGCCGAAG
TCCAAAGCGGAATCCATCCCGCGCTTTGTTGATGAGCGCAAACCATCCAGGGCTTTTGATCATTTGGATA
TTGATGCTTCTTTTGGCGATTGCGAGGATTGA
 Primer design