SecReT4
Protein ID: 153008021
T4SS name [ID]VirB [220]
Gene symbol-
Locus tagOant_0682
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 1 [GenBank: NC_009667] [Browse all T4SS(s) in this replicon]
Location [Strand]708148..708819 [+]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA6WWQ3
KEGG IDoan:Oant_0682
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.4e-64, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|153008021|ref|YP_001369236.1| VirB8 family protein [Ochrobactrum anthropi ATCC 49188]
MVTTDNLKSYFEKARRFDQDRMIQVERSNRVAWSIAIAAGIVAGISILAVASLAPLKTVEPFVVRVDNST
GIVDVVSALSATAGTYDEAVTKYFAAKYVRGREGYVWSEAQENFRTIALLSTQAEQARFAATYRGSNPQS
PQNVYGRSATVRINIVSIALINQNVVSVRYMRSVTRGEEVRTTHFVATLTYSYANAPMSSTDRLVNPLGF
AVSEYRADPEAID
 
Nucleotide Sequence: 672 bp     [Download]
>gi|153007346|ref|NC_009667.1|:708148-708819 Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence
ATGGTCACGACAGATAATCTCAAAAGCTATTTCGAGAAAGCGCGTCGCTTTGATCAAGACCGCATGATTC
AGGTCGAGCGATCAAATCGCGTGGCGTGGTCGATCGCAATTGCTGCCGGTATTGTTGCCGGCATATCAAT
CCTCGCCGTTGCGAGCTTAGCGCCGCTGAAAACTGTCGAACCTTTCGTGGTTCGTGTCGACAATTCTACC
GGGATCGTGGATGTCGTTTCAGCGCTGTCGGCGACCGCTGGCACTTACGACGAAGCCGTGACCAAATATT
TTGCGGCAAAATATGTTCGTGGACGCGAAGGCTATGTCTGGAGCGAAGCCCAGGAGAATTTTCGAACAAT
TGCGCTTCTCTCTACGCAAGCCGAACAGGCGCGGTTCGCAGCTACTTATCGTGGCAGCAATCCGCAATCA
CCACAAAATGTCTATGGCCGTTCTGCCACGGTGCGGATTAACATCGTCTCCATCGCGCTCATCAATCAAA
ACGTGGTGTCGGTACGCTACATGCGTAGCGTAACCCGCGGTGAAGAAGTCCGGACAACACATTTTGTTGC
GACCCTCACCTATTCCTACGCCAACGCTCCCATGTCATCGACAGACCGACTGGTGAATCCGCTTGGTTTC
GCTGTTAGCGAATATCGGGCAGATCCGGAGGCAATCGATTGA
 Primer design