SecReT4
Protein ID: 153008024
T4SS name [ID]VirB [220]
Gene symbol-
Locus tagOant_0685
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 1 [GenBank: NC_009667] [Browse all T4SS(s) in this replicon]
Location [Strand]710869..711870 [+]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDA6WWQ6
KEGG IDoan:Oant_0685
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.7e-81, Aligned region: 15..316
Protein Sequence: 333 a.a.     [Download]
>gi|153008024|ref|YP_001369239.1| P-type DNA transfer ATPase VirB11 [Ochrobactrum anthropi ATCC 49188]
MAEAQDSAVVLELLKPLAVFLNDCSLYEIIVNHPGQVLTEGPGGWQIHDLSGLSFEKLMRLSRAVASFSH
QTINETRPILSATLPNGERIQIVIPPATTKGTVSITIRKPSSLDFTLDDLDANGFFSQTQTSFRTLSKEQ
ERLQELYKKGQFKEFLRQAVIARKNIIISGATGSAKTTLSKALIKHIPQHERVISIEDSPELIISQPNQV
RLFYSKGSQGLSNAGPKELLESCLRMRPDRILLQELRDGSAFYYIRNINSGHPGSITTVHADSARLAFEQ
LTLLVKESEGGSALERADIRRMLEISVDVVVQCKRTDGTFRAAEIYFSGCAND
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|153007346|ref|NC_009667.1|:710869-711870 Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence
ATGGCTGAAGCCCAGGACAGCGCCGTCGTTCTTGAACTTCTAAAGCCTCTCGCGGTCTTCCTGAATGATT
GCTCGTTATATGAGATCATTGTCAATCATCCGGGTCAGGTGCTGACGGAAGGGCCGGGTGGTTGGCAGAT
ACACGATCTTTCTGGGCTTTCCTTTGAAAAACTCATGCGCCTTTCCCGGGCGGTGGCAAGCTTTTCCCAT
CAAACCATCAATGAAACGCGACCGATACTTTCGGCAACACTTCCAAATGGCGAGCGAATTCAAATTGTCA
TTCCACCGGCCACCACGAAGGGAACGGTCAGCATCACAATTCGGAAGCCATCATCGCTTGATTTTACGCT
TGATGATCTGGACGCCAATGGCTTTTTCTCTCAGACGCAAACAAGCTTCCGTACCCTTTCAAAAGAGCAA
GAACGTTTACAAGAACTCTACAAAAAAGGGCAATTCAAGGAGTTTCTTCGTCAAGCTGTTATCGCGCGGA
AAAATATTATTATCTCTGGCGCGACGGGATCTGCAAAAACCACTCTTTCAAAAGCTCTTATCAAGCATAT
TCCACAACACGAGCGTGTCATTTCGATTGAAGACAGCCCGGAACTTATAATTTCCCAACCAAATCAGGTG
CGTCTGTTTTATTCGAAGGGTTCGCAGGGACTATCAAATGCAGGTCCGAAGGAATTGCTCGAATCGTGCC
TGCGAATGCGTCCCGATCGTATATTGCTGCAGGAACTGAGAGACGGAAGCGCGTTTTATTATATTCGCAA
TATCAACTCGGGCCATCCAGGATCCATCACAACAGTTCATGCAGATTCTGCCAGACTTGCCTTCGAGCAA
CTGACTTTACTAGTCAAGGAATCGGAAGGGGGAAGCGCACTCGAACGCGCTGACATCCGACGTATGTTGG
AGATTTCGGTTGACGTTGTTGTGCAATGTAAACGCACCGATGGAACGTTCCGCGCTGCTGAAATTTACTT
CTCCGGCTGTGCGAACGATTGA
 Primer design