SecReT4
Protein ID: 153010512
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3189
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]513800..514345 [+]
Productconjugal transfer protein precursor
Component typeTraF
UniProt IDA6X3U3
KEGG IDoan:Oant_3189
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.6e-50, Aligned region: 29..166
Protein Sequence: 181 a.a.     [Download]
>gi|153010512|ref|YP_001371726.1| conjugal transfer protein precursor [Ochrobactrum anthropi ATCC 49188]
MTRFRYVMVTTVATLGIAFAGFVPTAPRLVWNASASVPIGFYTVAPDDRIAVPDLVAVIPPEPFASFMVE
RGYVARDVPLLKHVLGLPGQRLCRDGRAIIVDGVPLGEARDHDSFGRDLPVWQGCRVIAEGEVFLMNPDV
GDSLDGRYFGPFPASAVIGHAIPLFTDEDGEGRFVWRAPMR
 
Nucleotide Sequence: 546 bp     [Download]
>gi|153010078|ref|NC_009668.1|:513800-514345 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGACGCGCTTTCGCTATGTCATGGTGACGACGGTTGCCACGCTCGGGATCGCCTTTGCCGGATTCGTTC
CGACTGCGCCAAGGCTGGTCTGGAACGCATCGGCCAGCGTGCCGATCGGGTTCTATACTGTCGCACCCGA
CGACCGGATCGCGGTGCCCGATCTGGTCGCCGTCATCCCACCCGAACCCTTCGCCTCGTTTATGGTCGAG
CGCGGCTACGTCGCACGCGACGTGCCGCTTCTGAAGCACGTTCTCGGCCTGCCCGGACAGCGCCTGTGCC
GCGATGGCCGCGCCATTATCGTCGACGGCGTTCCGCTCGGCGAGGCGCGCGACCACGACAGCTTCGGCCG
AGACCTGCCGGTCTGGCAGGGCTGTCGCGTCATCGCCGAGGGCGAAGTGTTCCTGATGAACCCGGACGTC
GGCGACAGCCTCGACGGCCGCTATTTCGGCCCGTTCCCCGCCTCGGCGGTGATCGGCCACGCGATCCCGC
TTTTCACCGACGAAGACGGCGAGGGCCGCTTTGTCTGGCGCGCGCCGATGCGGTGA
 Primer design