SecReT4
Protein ID: 153010514
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3191
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]514752..515516 [+]
Productlytic transglycosylase
Component typeTrbN
UniProt IDA6X3U5
KEGG IDoan:Oant_3191
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|153010514|ref|YP_001371728.1| lytic transglycosylase [Ochrobactrum anthropi ATCC 49188]
MVTSCIRPASGRCGARRRILLLLLSGLFVTAIAPLPGLAQIAVMGRAVAVHPHGAHIEEASQRFGIPAAW
IIAVMQVESAGNMHAISSAGAMGLMQVMPSTWAELRIRHALGRDPFEPRDNILAGTAYLREMWDRYGNVA
AMLAAYNAGPGRYDEYRATARPLPAETRAYVAALTPILLGERPSGSGSTVAPPPDWREAALFVAREIGAS
AADPASPDRTPDDAPSLVPAAPDALTALQSEGLFVARDAGGDRP
 
Nucleotide Sequence: 765 bp     [Download]
>gi|153010078|ref|NC_009668.1|:514752-515516 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGGTCACGTCCTGCATCCGTCCCGCCTCGGGGAGATGTGGCGCCCGCCGCCGCATCCTCCTCCTTCTTC
TTTCCGGCCTGTTCGTCACAGCCATTGCCCCGCTGCCCGGCCTGGCGCAGATCGCCGTGATGGGTCGTGC
CGTCGCCGTGCATCCGCACGGCGCCCATATCGAAGAGGCTTCGCAGCGGTTCGGCATCCCGGCGGCATGG
ATCATCGCCGTGATGCAGGTCGAAAGCGCGGGCAATATGCACGCCATATCGTCTGCCGGCGCGATGGGGC
TGATGCAGGTCATGCCCTCGACTTGGGCGGAGCTGCGCATCCGCCATGCTCTCGGCCGCGACCCCTTCGA
GCCGCGCGACAACATCCTCGCGGGCACCGCCTACCTACGCGAGATGTGGGATCGCTACGGCAATGTTGCC
GCGATGCTCGCGGCCTACAATGCCGGTCCCGGTCGCTACGATGAATACCGCGCGACGGCTCGTCCGCTGC
CTGCCGAGACGCGCGCCTATGTCGCTGCTTTGACGCCGATCCTGCTCGGCGAGCGGCCTTCCGGCAGCGG
CTCGACGGTCGCTCCGCCGCCCGACTGGCGCGAGGCGGCGCTCTTCGTCGCGCGTGAAATCGGCGCTTCC
GCTGCCGATCCCGCGTCCCCCGACCGCACGCCGGACGATGCCCCTTCGCTCGTCCCGGCGGCACCGGACG
CACTCACCGCCTTGCAGTCGGAGGGGCTGTTCGTCGCCCGCGATGCCGGTGGGGACCGGCCATGA
 Primer design