SecReT4
Protein ID: 153010516
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3193
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]517524..519509 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA6X3U7
KEGG IDoan:Oant_3193
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-105, Aligned region: 111..555
TraG-D_C [PF12696], Evalue: 8.2e-31, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 5.5e-28, Aligned region: 171..536
AAA_10 [PF12846], Evalue: 1.2e-06, Aligned region: 146..478
Protein Sequence: 661 a.a.     [Download]
>gi|153010516|ref|YP_001371730.1| conjugal transfer coupling protein TraG [Ochrobactrum anthropi ATCC 49188]
MSATKILWGQITIVFLIILATTWGATQYVASSLGYQAQLGPPWFVMFGVPIYYPPAIFWWWYFYEAYAPP
IFAKGGIIAASGGFIAIAVAIGMSVWRAREAKNVATYGSARWAGKGEIKAAGLLDPDGVVLGRYEKDYLR
HDGPEHVLCFAPTRSGKGVGLVVPSLLTWPGSAIVHDIKGENWQLTSGFRSQHGRVLLFDPTNPKSSAYN
PLLEVRRGEWEVRDVQNIADILVDPEGSLDKRNHWEKTSHSLLVGAILHVLYAEPDKTLAGVAKFLSDPK
RPVDSTLRAMMKTAHLGEAGPHPVVASAARELRNKSENERSGVLSTAMSFLGLYRDPVVAEVTRRSDWRI
SDIVGGDQPVTLYLVVPPSDINRTKPLMRLLLNQIGRRLTEDLQANAGRHRLLLMLDEFPALGRLDFFET
ALAFMAGYGLKSFLIAQSLNQIEKAYGPNNSILDNCHVRVSFATNDERTAKRVSDALGTATEMKAMKNYA
GHRLSPWLGHLMVSRSETARQLLTPGEIMQLPPHEEIVMVAGIPPIRATKARYYEDARFRERVLSPPELK
GPEETRPDDWTKLPIPARPEGATDHGDQRTNDEDPTESERRLQPELSRVKPVEKKKPLENEFEIAPPDEV
EEEAMQNRRMIRQVQGIARQVAMDPNDGMEL
 
Nucleotide Sequence: 1986 bp     [Download]
>gi|153010078|ref|NC_009668.1|:517524-519509 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGTCCGCGACCAAGATCCTCTGGGGACAGATCACCATCGTCTTCCTCATCATCCTCGCCACCACCTGGG
GCGCGACCCAGTATGTCGCCTCGAGCCTCGGTTATCAGGCGCAACTCGGGCCGCCCTGGTTCGTGATGTT
CGGCGTGCCGATCTATTATCCGCCCGCGATCTTCTGGTGGTGGTATTTCTACGAAGCCTATGCGCCGCCG
ATCTTCGCCAAGGGCGGGATCATCGCGGCATCGGGCGGCTTCATCGCCATTGCCGTCGCCATCGGCATGT
CGGTCTGGCGGGCGCGCGAGGCGAAAAACGTCGCCACCTATGGCTCGGCGCGATGGGCCGGGAAAGGAGA
GATCAAGGCGGCGGGCCTGCTCGATCCCGATGGTGTTGTTCTCGGCCGTTACGAGAAGGACTATCTACGC
CATGACGGGCCGGAGCATGTCCTGTGCTTTGCCCCGACACGTTCGGGCAAAGGCGTCGGCCTCGTCGTCC
CGTCGCTGCTGACCTGGCCGGGGTCGGCCATCGTCCACGACATCAAGGGTGAGAACTGGCAGCTCACCTC
CGGCTTCCGCTCGCAGCACGGCCGCGTGCTGCTCTTCGACCCGACCAACCCGAAATCCTCGGCCTACAAT
CCGCTGCTGGAAGTGCGCCGCGGCGAGTGGGAGGTGCGCGACGTCCAGAACATCGCCGACATCCTCGTCG
ATCCGGAAGGCAGTCTCGACAAGCGCAACCATTGGGAAAAGACCAGCCATTCGCTGCTGGTGGGCGCCAT
CCTGCATGTGCTTTACGCCGAACCCGACAAGACCCTGGCAGGTGTGGCCAAATTCCTGTCCGATCCGAAG
CGCCCGGTGGATTCCACGTTGCGCGCCATGATGAAGACCGCGCATCTGGGCGAAGCGGGGCCGCACCCGG
TCGTTGCCAGCGCCGCGCGCGAGCTGCGCAACAAGTCCGAGAACGAGCGCAGCGGCGTGTTGTCGACGGC
GATGTCGTTTCTCGGCCTGTATCGCGATCCGGTCGTGGCCGAAGTCACACGCCGCTCCGACTGGCGCATC
AGCGATATTGTGGGAGGCGATCAGCCGGTCACGCTTTACCTCGTCGTGCCGCCCTCCGACATCAACCGCA
CCAAGCCGCTGATGCGATTGCTGCTCAATCAGATCGGCCGTCGCCTGACCGAAGACCTGCAGGCGAACGC
CGGGCGGCATCGGCTCCTTCTGATGCTGGACGAGTTTCCGGCGCTGGGCAGGCTCGATTTCTTCGAGACC
GCGCTGGCTTTCATGGCCGGCTACGGTCTGAAATCATTCCTGATCGCGCAGTCGCTGAACCAGATCGAGA
AAGCCTACGGGCCGAACAACTCGATCCTCGACAACTGCCATGTCCGCGTCAGCTTCGCCACCAACGACGA
GCGCACGGCGAAACGGGTGTCGGATGCGCTCGGCACCGCCACCGAGATGAAGGCGATGAAGAACTATGCC
GGCCATCGCCTGTCGCCCTGGCTCGGGCACCTTATGGTCTCGCGCTCGGAAACCGCGCGCCAGTTGCTGA
CGCCGGGCGAGATCATGCAGCTTCCCCCACATGAGGAGATCGTCATGGTGGCGGGCATCCCCCCGATCCG
GGCGACGAAGGCGCGCTATTACGAGGACGCCCGGTTTCGCGAGCGCGTTCTGTCACCGCCTGAATTGAAA
GGTCCCGAAGAAACGCGGCCCGACGACTGGACCAAGCTTCCGATCCCGGCGCGACCGGAAGGCGCCACGG
ATCACGGCGACCAGAGAACCAATGACGAAGATCCGACCGAATCCGAACGCCGATTGCAGCCTGAACTCAG
CCGCGTAAAGCCCGTGGAGAAGAAAAAGCCCCTCGAGAACGAATTCGAGATCGCGCCGCCCGATGAAGTT
GAGGAAGAGGCCATGCAAAATCGGCGCATGATCCGCCAGGTGCAGGGCATTGCCCGGCAGGTTGCCATGG
ACCCGAACGACGGCATGGAGCTGTAG
 Primer design