SecReT4
Protein ID: 153010535
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3212
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]533536..534534 [+]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDA6X3W6
KEGG IDoan:Oant_3212
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.4e-87, Aligned region: 25..291
FtsK_SpoIIIE [PF01580], Evalue: 8.8e-06, Aligned region: 140..178
TrwB_AAD_bind [PF10412], Evalue: 3.4e-05, Aligned region: 148..184
Protein Sequence: 332 a.a.     [Download]
>gi|153010535|ref|YP_001371749.1| P-type conjugative transfer ATPase TrbB [Ochrobactrum anthropi ATCC 49188]
MPGINHKQANVDRGARMLRTALGPAISTLLQDPSVVEVMLNPDGRIWVDRLSEGLADTGEILSAADGERI
VRLVAHHVGVEVHARSPRVSAELPETGERFEGLLPPVVSAPAFAIRKPAVAVFTLDDYVAAGIMSADQAE
TLRAAVASRANILVAGGTSTGKTTLTNALLAEVAKTQDRVVIIEDTRELQCAASNLVAMRTKDGVATLSE
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSGIGALRRLEQLIQEAVVTVPRAMIA
ETIDLVAVLAGRGSARRLAELACVEGLGPDGDYRISLAFPDTSIPHVPGEPA
 
Nucleotide Sequence: 999 bp     [Download]
>gi|153010078|ref|NC_009668.1|:533536-534534 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGCCAGGCATCAACCACAAACAGGCAAATGTGGACCGCGGCGCGCGCATGCTCCGGACAGCGCTCGGGC
CTGCCATCTCAACCCTGCTGCAAGACCCGTCTGTCGTCGAGGTCATGCTGAACCCGGACGGACGCATCTG
GGTGGACCGGCTGTCCGAAGGGTTGGCCGATACGGGCGAAATACTGTCCGCCGCTGACGGTGAGCGCATC
GTGCGGCTGGTCGCCCACCATGTCGGCGTCGAAGTCCATGCGCGCAGCCCGCGCGTCTCGGCCGAACTGC
CCGAAACCGGCGAGCGCTTCGAGGGGTTGCTGCCGCCGGTCGTGTCCGCACCCGCCTTCGCCATCCGCAA
GCCCGCGGTCGCAGTATTCACGCTAGACGACTATGTGGCCGCCGGCATCATGTCCGCCGATCAGGCGGAA
ACGCTCCGCGCGGCCGTCGCGTCCCGCGCCAACATCCTTGTCGCAGGCGGCACGTCCACCGGTAAAACGA
CGCTGACCAATGCGCTGCTCGCCGAGGTGGCGAAGACGCAGGATCGGGTCGTCATCATCGAGGACACCCG
CGAACTGCAATGCGCAGCGTCGAATCTCGTGGCGATGCGCACCAAGGATGGTGTCGCCACCTTGTCGGAA
CTGGTGCGGTCTTCGCTGCGCCTGCGTCCGGACCGCATTCCGATCGGTGAGGTGCGCGGCGCCGAGGCGC
TCGATCTCCTCAAAGCCTGGGGCACCGGCCATCCGGGCGGCATCGGCACCATCCATGCTGGTTCCGGCAT
CGGCGCCCTGCGCCGCCTCGAACAACTCATCCAGGAAGCCGTCGTCACTGTGCCGCGCGCGATGATCGCG
GAGACCATCGACCTCGTGGCCGTCCTCGCTGGCCGCGGCTCCGCGCGCCGGCTGGCCGAACTTGCCTGCG
TCGAAGGGCTCGGCCCCGACGGCGATTACCGGATTTCCCTCGCTTTTCCCGACACCTCAATCCCTCACGT
TCCAGGAGAACCTGCATGA
 Primer design