SecReT4
Protein ID: 153010536
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3213
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]534531..534860 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA6X3W7
KEGG IDoan:Oant_3213
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.6e-24, Aligned region: 8..99
Protein Sequence: 109 a.a.     [Download]
>gi|153010536|ref|YP_001371750.1| conjugal transfer protein TrbC [Ochrobactrum anthropi ATCC 49188]
MIRCAVRIRHHLATAAAFTWASLMTAPAQASGSSMPWEAPLQSILESVEGPVAKIVAVIIIIVTGLTLAF
GDTGGGFRRLIQIVFGISIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 330 bp     [Download]
>gi|153010078|ref|NC_009668.1|:534531-534860 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGATCCGTTGCGCCGTTCGTATCCGTCATCATCTGGCGACCGCCGCCGCCTTCACCTGGGCGAGCCTGA
TGACTGCCCCCGCCCAAGCGTCTGGCTCCTCCATGCCCTGGGAAGCGCCGCTGCAATCCATCCTTGAATC
CGTCGAAGGCCCGGTGGCCAAGATCGTGGCAGTGATCATCATCATCGTCACCGGCCTGACGCTCGCATTC
GGCGATACCGGCGGCGGCTTCCGTCGCCTCATCCAGATCGTCTTCGGTATCTCCATCGCCTTCGCGGCGT
CCAGCTTCTTCCTCTCGTTCTTCAGCTTCGGCGGCGGAGCGCTGGTCTGA
 Primer design