SecReT4
Protein ID: 153010538
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3215
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]535150..537660 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA6X3W9
KEGG IDoan:Oant_3215
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.5e-35, Aligned region: 442..723
CagE_TrbE_VirB [PF03135], Evalue: 3.1e-15, Aligned region: 184..388
Protein Sequence: 836 a.a.     [Download]
>gi|153010538|ref|YP_001371752.1| conjugal transfer ATPase TrbE [Ochrobactrum anthropi ATCC 49188]
MMNLAEYRRTASRLADYLPWVALVGFGVVLNKDGSFQRTAKFRGPDLDSAVAAELVAVAGRLNNAFRRLG
SGWAIFVEAQRSEAATYPASRFPDPASALVDAERKADFEEKGSHFVSGYFLTFLWLPPAEDAARSESWLY
EGRETSSVNPWELVRGFADRTDRVLALLDGFMPECRWLDDAGTLTYLHSTISINRHRVRVPETPTYLDAL
LADQPLTGGLEPRLGNQHLRVLTITGFPATTTPGLLDEMNRLAFPYRWSTRAILMDKTDATRLLTKIRRQ
WFAKRKSIAAILKEVMTNEQSALVDTDAANKAADADMALQELGADMAGMAYVTATVTVWDEDARRADEKL
RLVEKIIQSRDFSVMVETVNAVDAWLGSLPGHAYANVRQPPVSTLNLAHMVPSSAVWAGPERDDHFGAPP
LLYGRTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYARSQVFAFDFGGSIRACALAMQ
GDWHDLGGELTDASETSVSLQPLARIHETAERAWAADWIVAILTRENIQITPEVKEHIWTALTSLASAPV
GERTITGLAVLLQSNDLKQALRAYCVGGPYGRLLDAETEHLGSADVQAFEIEGLVGTGAAPAVLSYLFHR
IGDRLDGWPTLLIIDEGWLALDDEGFADQLREWLKTLRKKNASVIFATQSLSDIDNSAIAPAIIESCPTR
LLLPNERAIEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFDLGLSEVGLALCAASAKSDQ
ALISEILTEHGRDGFLAAWLKARGVEWAAELIPDLSNLATESEDLPSVIFDEDAFELTLEEEESTP
 
Nucleotide Sequence: 2511 bp     [Download]
>gi|153010078|ref|NC_009668.1|:535150-537660 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGATGAATCTCGCCGAATACCGCCGTACCGCATCCCGCCTCGCCGATTACCTTCCCTGGGTAGCGCTGG
TCGGCTTCGGCGTTGTCCTCAACAAGGACGGCTCGTTCCAGCGCACCGCGAAGTTTCGCGGTCCCGATCT
GGATTCCGCCGTCGCGGCCGAGCTGGTCGCGGTCGCTGGCCGCCTTAACAATGCCTTCCGTCGCCTCGGC
TCCGGCTGGGCGATCTTCGTCGAAGCACAGCGGTCGGAAGCCGCCACCTATCCGGCGAGCCGCTTCCCCG
ATCCCGCATCGGCGCTGGTCGATGCCGAGCGCAAGGCCGATTTCGAGGAGAAAGGCAGCCATTTCGTCTC
TGGCTATTTCCTGACCTTCCTCTGGCTTCCGCCCGCCGAGGATGCCGCCCGCTCCGAGTCCTGGCTTTAC
GAGGGCCGCGAAACGTCGAGCGTGAACCCTTGGGAACTGGTGCGCGGCTTTGCCGACCGCACCGACCGCG
TGCTGGCGCTGCTCGACGGTTTTATGCCGGAATGCCGCTGGCTCGATGACGCCGGGACGCTGACTTACCT
GCATTCGACGATTTCGATCAACCGGCATCGCGTCCGCGTGCCCGAAACCCCGACCTATCTCGATGCGCTG
CTGGCCGATCAGCCGCTGACCGGCGGGCTGGAGCCGCGCCTGGGCAATCAGCATCTCCGGGTGCTGACGA
TCACCGGCTTTCCGGCAACCACCACCCCCGGCCTGCTCGACGAAATGAACCGGTTGGCCTTTCCCTATCG
CTGGTCGACCCGCGCCATCCTCATGGACAAGACCGATGCGACCCGGCTGCTGACGAAGATCAGGCGCCAG
TGGTTCGCCAAGCGCAAGTCGATTGCCGCCATCCTGAAAGAGGTGATGACCAACGAGCAATCCGCGCTCG
TCGACACCGACGCCGCCAACAAGGCGGCCGATGCCGACATGGCCCTGCAGGAACTTGGCGCCGACATGGC
GGGCATGGCCTATGTCACGGCGACCGTCACCGTTTGGGACGAGGACGCCCGCCGCGCCGACGAAAAGCTG
CGGCTGGTCGAGAAGATCATCCAGTCCCGCGATTTCAGCGTCATGGTCGAAACGGTCAACGCCGTCGACG
CCTGGCTCGGCAGCTTGCCCGGACATGCCTATGCGAATGTCCGGCAACCGCCGGTCTCGACGCTCAACCT
TGCCCACATGGTCCCTTCGTCCGCCGTGTGGGCGGGACCGGAACGGGACGATCACTTCGGCGCGCCCCCG
CTGCTGTATGGCAGGACCGAAGGATCGACCCCGTTCCGGTTTTCCCTCCATGTCGGCGATGTCGGCCATA
CGCTTGTCGTCGGGCCGACGGGTGCCGGCAAATCGGTGCTGCTGGCGCTAATGGCCTTGCAGTTCCGGCG
CTACGCGCGCTCACAGGTCTTTGCCTTCGATTTCGGCGGCTCGATCCGGGCCTGCGCCCTCGCGATGCAA
GGTGACTGGCACGATCTTGGTGGCGAGCTGACCGACGCTTCCGAAACATCCGTCTCGCTGCAACCTCTGG
CGCGCATTCACGAGACGGCCGAACGCGCCTGGGCCGCCGACTGGATCGTGGCGATCCTGACGCGCGAGAA
CATCCAGATCACCCCGGAGGTGAAGGAGCACATCTGGACGGCCCTGACCTCGCTCGCCTCCGCCCCGGTC
GGGGAACGCACCATCACCGGCCTCGCCGTGCTGCTCCAGTCGAATGATCTGAAACAGGCGCTCCGCGCCT
ATTGCGTCGGTGGTCCCTATGGCCGGCTGCTCGATGCGGAGACCGAACATCTTGGTTCAGCAGACGTGCA
GGCATTCGAAATCGAGGGCCTTGTCGGGACCGGCGCGGCGCCCGCGGTCCTCTCTTATCTCTTCCACCGC
ATCGGCGACCGGCTAGACGGGTGGCCCACGCTGCTGATCATCGACGAGGGCTGGCTGGCGCTCGACGACG
AAGGCTTCGCGGACCAACTCAGGGAATGGCTCAAAACCCTGCGAAAGAAGAACGCCAGCGTCATCTTCGC
CACGCAGTCACTGTCCGACATCGACAATTCAGCCATCGCGCCGGCGATCATCGAAAGCTGCCCAACGCGG
CTGTTGCTGCCCAACGAGCGCGCCATCGAACCCCAGATCACCGCGATCTATCGCCGTTTCGGCCTCAATG
ACAGGCAGATCGAGATCCTCGCACGGGCCACGCCCAAGCGGGACTACTACTGCCAGTCGCGGCGCGGCAA
CCGCCTGTTTGACCTCGGATTGTCGGAAGTCGGGCTGGCGCTTTGCGCCGCATCGGCCAAATCCGATCAG
GCCCTGATCAGCGAAATCCTCACCGAGCATGGCCGCGACGGGTTCCTCGCCGCCTGGCTCAAGGCGCGTG
GCGTCGAATGGGCCGCAGAACTGATCCCGGACCTCAGCAATCTCGCGACCGAAAGCGAGGATCTGCCGTC
CGTCATTTTCGATGAGGACGCGTTCGAGCTCACCCTGGAAGAAGAGGAAAGTACCCCATGA
 Primer design