SecReT4
Protein ID: 153010539
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3216
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]537657..538439 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA6X3X0
KEGG IDoan:Oant_3216
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 260 a.a.     [Download]
>gi|153010539|ref|YP_001371753.1| conjugal transfer protein TrbJ [Ochrobactrum anthropi ATCC 49188]
MTRTKTRISRMASASALALSLAAPLALAPDFITPAHAFFGGFGRIVYDPTNHAENLLTAARTLEQINNQI
TSLQNEAQMLINQARNLASLPHSSLQALQQNVQRTQQLLGQAQNIAFDVQNIDQMFQQDYGKLSLTATDT
QMIADARSRWENTVGGLQDAMRVQAGVVGNIDSNRTQMSELVGQSQGATGALQATQAGNQLLALQSQQLS
DLIAVISANGRANALTEAERATAAEQGRIQRERFLTPGSGYQPGNARMFN
 
Nucleotide Sequence: 783 bp     [Download]
>gi|153010078|ref|NC_009668.1|:537657-538439 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGACGCGCACAAAGACCCGGATTTCCCGCATGGCCAGCGCTTCGGCGCTCGCCCTTTCGCTTGCCGCGC
CGCTGGCGCTCGCGCCGGACTTCATCACCCCGGCCCATGCCTTCTTCGGCGGGTTCGGCCGGATCGTCTA
TGATCCGACCAACCACGCGGAGAATCTGCTGACCGCCGCCCGTACGCTGGAGCAGATCAACAACCAGATC
ACCTCGCTTCAGAACGAGGCGCAGATGCTGATCAACCAGGCCCGCAATCTCGCGAGCCTGCCTCACAGCT
CGCTTCAGGCGCTTCAGCAGAACGTCCAGCGGACCCAGCAGCTTCTCGGGCAGGCCCAGAACATTGCGTT
CGACGTTCAGAACATCGATCAGATGTTCCAGCAGGACTACGGCAAGCTGTCTTTGACCGCGACCGACACC
CAGATGATCGCCGATGCGCGCTCGCGCTGGGAAAACACCGTCGGCGGCCTGCAGGACGCCATGCGCGTCC
AGGCCGGCGTCGTCGGCAATATCGACAGCAATCGCACGCAAATGTCGGAGCTTGTCGGCCAAAGCCAGGG
GGCGACCGGCGCGCTTCAGGCGACCCAGGCTGGCAACCAGCTTCTCGCCCTCCAGTCGCAGCAGCTTTCG
GACCTGATCGCTGTCATCTCGGCCAATGGCCGGGCGAATGCCTTGACCGAGGCCGAACGCGCCACGGCAG
CCGAACAGGGACGCATTCAGCGCGAGCGTTTCCTGACGCCGGGGTCAGGCTATCAGCCCGGCAACGCGCG
AATGTTCAACTGA
 Primer design