SecReT4
Protein ID: 153010541
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3218
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]538747..540105 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA6X3X2
KEGG IDoan:Oant_3218
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-52, Aligned region: 37..262
Protein Sequence: 452 a.a.     [Download]
>gi|153010541|ref|YP_001371755.1| conjugal transfer protein TrbL [Ochrobactrum anthropi ATCC 49188]
MGGTGVIDNFLGIFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWAWGADGDIIARLVKKTLFVGVF
AYLISNWNNLARIVFESFAGLGLMASGTGFSVADLLRPGRVAQTGLDAGRPLLESISDLMGWIAFFENFI
QIACLLFAWALVVLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFGQFTAGFGGATPTIDDAMAIVLAALSLLGLGIFGPGIATGLVSGGPQLSAGAAVGTGLA
VGGAAIAAGGATMLAARGGAAALSGGAALARGGASAAGAASSAYTLGSLGGSGTAGVASGLGGVARAGAS
AAVSPLKRAASRASDSLKSSYSDGAKAGFAASGGTSTMGTVGRDSSPAPSTPSTPDGPPAWAQQMRRGRA
MSHGVTAAAHAVRSGDSHGGGSSVSLSESDRT
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|153010078|ref|NC_009668.1|:538747-540105 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGGGCGGAACGGGGGTCATCGATAATTTTCTCGGCATCTTCACCAGCTATATCGACTCCGGCTTCGGCC
TGCTCGGCGGCGAGGTGGCGTTTATCGCCACGACGCTGATCGTCATCGACGTGACGCTCGCCGCACTGTT
CTGGGCCTGGGGCGCCGACGGCGACATCATTGCGCGGTTGGTGAAAAAGACGCTGTTCGTCGGCGTCTTC
GCCTATCTCATCAGCAACTGGAACAATCTCGCACGGATCGTCTTCGAGAGCTTCGCCGGGCTCGGGCTCA
TGGCGTCCGGCACTGGCTTCTCGGTTGCCGATCTGCTGCGCCCCGGCCGCGTTGCCCAAACCGGGCTGGA
CGCCGGTCGCCCGCTGCTGGAATCTATTTCGGACCTGATGGGCTGGATCGCCTTCTTCGAGAACTTCATC
CAGATCGCGTGCCTGTTGTTCGCCTGGGCGCTGGTGGTGCTGGCCTTTTTCATCCTGGCAATCCAGCTTT
TCGTCACGCTGATCGAGTTCAAGCTGACCACGCTGGCCGGCTTCGTGCTGATTCCATTCGGCCTGTTCGG
CAAGACCGCCTTCATGGCCGAGCGGGTGCTGGGCAATGTGATCTCCAGCGGTATCAAGGTGCTGGTCCTC
GCCGTCATCATCGGCATCGGCTCCACGCTCTTCGGCCAGTTTACCGCAGGCTTCGGCGGTGCGACCCCGA
CAATCGACGACGCCATGGCGATCGTGCTGGCAGCCCTTTCCCTTCTCGGCCTCGGCATCTTCGGCCCCGG
CATCGCCACCGGCCTCGTCTCCGGAGGCCCGCAACTCAGTGCCGGCGCCGCCGTCGGGACTGGCCTTGCG
GTTGGCGGCGCTGCGATCGCAGCCGGTGGCGCGACCATGCTCGCGGCGCGGGGTGGCGCAGCCGCACTCT
CGGGCGGGGCAGCACTTGCCCGCGGCGGTGCCTCGGCCGCCGGTGCGGCTTCGTCCGCCTATACCCTCGG
CTCCTTGGGCGGGTCCGGCACGGCCGGGGTCGCCTCCGGCCTTGGCGGTGTGGCGCGCGCCGGAGCCTCC
GCCGCCGTTTCACCACTCAAGCGCGCCGCCTCCCGCGCCAGCGACAGCCTGAAATCCAGCTATTCCGATG
GTGCGAAAGCCGGATTCGCGGCATCCGGCGGCACGTCGACCATGGGCACCGTCGGCAGAGATTCGTCGCC
TGCGCCGTCAACCCCCTCAACCCCTGATGGGCCGCCGGCCTGGGCGCAGCAGATGCGGCGTGGCCGGGCC
ATGAGCCACGGCGTCACGGCTGCTGCTCATGCTGTCCGATCCGGCGACAGCCACGGCGGCGGCTCCTCCG
TCAGCCTTTCCGAAAGTGACCGCACATGA
 Primer design