SecReT4
Protein ID: 153010542
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3219
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]540102..540791 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA6X3X3
KEGG IDoan:Oant_3219
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-61, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|153010542|ref|YP_001371756.1| conjugal transfer protein TrbF [Ochrobactrum anthropi ATCC 49188]
MNIFKRPTTHYGKVPEPETPYQKAAQVWDERIGSARVQAKNWRYMAFGCLILSAGFAAALVWQSARGTVV
PWVVQVDNLGQAQAVAPANADYRPTDPQIAFHLGRFIEQVRAIPADAIIVRQNWLRAYEFTTDRGAAALN
DYARANDPFTKVGRQQIAVEVSSVIRASPDSFRVAWTERHFENGQLSTTERWTAILTVVIQPPRDAERLR
ANPLGIYINAISWSREMSQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|153010078|ref|NC_009668.1|:540102-540791 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGAACATCTTCAAACGACCGACGACCCATTACGGCAAGGTGCCGGAACCCGAGACTCCCTATCAAAAAG
CCGCACAGGTCTGGGACGAACGCATCGGCTCGGCCCGCGTGCAGGCGAAGAACTGGCGCTATATGGCGTT
CGGCTGTCTGATCCTCTCGGCCGGCTTTGCCGCCGCGCTCGTCTGGCAATCGGCGCGTGGAACCGTCGTG
CCCTGGGTGGTGCAGGTGGACAATCTCGGTCAGGCGCAGGCTGTCGCGCCCGCGAACGCCGATTATCGCC
CGACCGATCCGCAGATCGCCTTCCATCTCGGCCGCTTCATCGAGCAGGTCCGCGCGATCCCGGCGGACGC
GATCATCGTCCGGCAGAACTGGCTTCGGGCTTACGAGTTCACCACCGACCGGGGCGCGGCGGCCTTGAAC
GATTATGCGCGGGCCAACGATCCCTTCACCAAGGTCGGCCGCCAGCAGATCGCCGTCGAGGTGTCGAGCG
TCATCCGGGCTTCGCCGGACAGTTTCCGCGTCGCCTGGACCGAACGCCATTTCGAGAACGGCCAGCTTTC
CACGACCGAGCGATGGACCGCGATCCTGACTGTCGTGATCCAGCCCCCGCGCGATGCCGAACGATTACGC
GCCAATCCGCTGGGAATCTACATCAACGCAATTTCATGGTCGCGGGAGATGAGCCAATGA
 Primer design