SecReT4
Protein ID: 153010543
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3220
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]540788..541816 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA6X3X4
KEGG IDoan:Oant_3220
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.9e-62, Aligned region: 104..322
Protein Sequence: 342 a.a.     [Download]
>gi|153010543|ref|YP_001371757.1| P-type conjugative transfer protein TrbG [Ochrobactrum anthropi ATCC 49188]
MTRTTFRRAGFPVFRKPAFAALLLSATMLAGCATNRTPQFNYDADVPPLPTVQTVATDDRPRPLHTPPAW
TVARGGTAASTPDGRVENANAAARVEPRREGYYNAIQIYPWSEGALYQVYAAPGQITNIALAPGESLTGA
GPIAAGDTTRWIIGDTESGSGANRRVHILVKPTRPDISTNLVVTTDRRTYMIELRARESLYMPSVAWAYP
AAPAGSRATTPAAPIIPAEAARNYRYGLQVRGDSPPWRPLSVFDDGRRVYVIFSRGIVQGEMPPLFVIGS
DGETQIVNSRVHQNVLIVDRLFGAAELRLGSGDRQQVVRIVRINPTQAAAEPASTTTGGSSS
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|153010078|ref|NC_009668.1|:540788-541816 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGACCCGCACGACTTTCCGTAGAGCCGGTTTTCCGGTTTTCCGTAAACCCGCTTTCGCGGCTTTGCTGC
TTTCCGCGACCATGTTGGCCGGCTGCGCGACCAACCGGACGCCGCAATTCAACTATGACGCCGACGTGCC
GCCGCTGCCCACCGTGCAGACGGTCGCCACCGACGACCGGCCCCGGCCGCTTCACACGCCGCCGGCCTGG
ACGGTCGCGCGGGGCGGAACTGCTGCCAGCACTCCGGACGGCCGTGTCGAAAACGCCAATGCCGCCGCCC
GTGTCGAACCTCGCCGTGAGGGCTATTACAACGCCATCCAGATTTATCCGTGGAGCGAAGGCGCGCTCTA
TCAGGTCTATGCGGCCCCCGGCCAGATCACAAATATCGCGCTGGCGCCGGGCGAAAGCCTGACCGGCGCG
GGACCTATTGCGGCCGGGGATACGACACGATGGATCATTGGCGACACCGAATCCGGTTCGGGCGCGAACC
GCCGCGTCCACATCCTCGTGAAGCCGACACGCCCGGACATTTCCACCAACCTTGTCGTGACCACCGACCG
GCGCACCTACATGATCGAGCTGCGCGCGCGGGAATCGCTCTACATGCCTTCCGTCGCATGGGCCTATCCC
GCGGCGCCGGCGGGAAGCCGTGCCACCACGCCCGCCGCGCCCATCATCCCCGCCGAGGCGGCGCGGAACT
ATCGCTACGGATTGCAGGTGCGGGGCGACAGCCCGCCATGGCGGCCGCTCTCCGTCTTCGACGATGGCCG
CCGCGTCTATGTCATTTTCTCGCGCGGCATCGTGCAGGGCGAAATGCCGCCTTTGTTCGTCATCGGGTCG
GACGGAGAAACGCAGATCGTCAACAGCCGTGTCCACCAGAATGTCCTGATCGTGGACCGCCTGTTCGGTG
CGGCCGAACTGCGCCTTGGCAGCGGCGATCGGCAGCAAGTGGTCAGGATCGTCCGCATCAACCCGACGCA
GGCCGCAGCAGAACCAGCCAGCACGACCACGGGAGGATCGTCGTCATGA
 Primer design