SecReT4
Protein ID: 153010544
T4SS name [ID]Trb [284]
Gene symbol-
Locus tagOant_3221
StrainOchrobactrum anthropi ATCC 49188
Repliconchromosome 2 [GenBank: NC_009668] [Browse all T4SS(s) in this replicon]
Location [Strand]541813..542940 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA6X3X5
KEGG IDoan:Oant_3221
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.2e-60, Aligned region: 192..370
Protein Sequence: 375 a.a.     [Download]
>gi|153010544|ref|YP_001371758.1| conjugation TrbI family protein [Ochrobactrum anthropi ATCC 49188]
MSDTDTAAPMRLRAEPPRVTRLSRKLLASVGAVALLGIAGTLIYALQTRDAGPGGGELYSTENRPTADGL
AGLPRDYTGPVLGPALPGDLGRPILDAQNRGQPVAPPAITTPAVDPEEERRRAEEEAARLSNVFFQSGSR
SGGTAGTAMPGIAGIGLQPDGTGQNRHAAFLNSPVDRQTVAPDRVTPPASPYILQAGAVIPAALITGIRS
DLPGQITAQVTENVYDSPTGSLLLIPQGTRIIGQYDDGVTFGQRRVLLVWNRLILPGGRSIVLERLPGAD
ASGYAGLEDGVDYHWWDLMKAAGLSTLLAVGTELATSDEDRLIRAIRDGAQDTVNQAGQQIVQRQLQVAP
TLTIRPGFPVRIIVTRDLVFEPAGG
 
Nucleotide Sequence: 1128 bp     [Download]
>gi|153010078|ref|NC_009668.1|:541813-542940 Ochrobactrum anthropi ATCC 49188 chromosome 2, complete sequence
ATGAGCGATACCGATACCGCCGCCCCCATGCGCCTGCGCGCCGAGCCGCCTCGTGTCACCCGCCTGTCCC
GAAAGTTGCTGGCAAGCGTTGGCGCGGTCGCGCTTCTCGGCATCGCCGGAACCTTGATCTATGCGCTCCA
GACCCGCGATGCGGGGCCGGGTGGCGGCGAACTCTATTCGACCGAAAACCGACCCACGGCTGACGGCCTC
GCCGGTCTGCCGCGCGACTATACCGGCCCCGTCCTGGGACCGGCATTGCCGGGCGACCTTGGCCGTCCGA
TCCTCGACGCGCAGAACCGGGGGCAGCCAGTCGCGCCTCCGGCAATCACCACACCAGCCGTCGATCCCGA
AGAGGAGCGCCGCCGCGCCGAGGAAGAGGCCGCGCGCTTGAGCAACGTGTTCTTCCAGTCCGGGTCGCGT
TCTGGCGGGACAGCGGGAACGGCCATGCCAGGAATAGCCGGGATAGGCTTGCAGCCGGACGGCACAGGGC
AGAACAGGCACGCGGCTTTCCTCAATAGCCCGGTCGACCGACAGACGGTTGCGCCAGATCGCGTCACGCC
GCCGGCATCGCCCTACATCCTTCAGGCTGGAGCCGTCATTCCGGCCGCACTCATCACCGGAATCCGCTCC
GATCTGCCGGGCCAGATCACCGCGCAGGTCACCGAAAACGTCTATGACAGCCCGACCGGCTCGCTGCTTC
TGATCCCGCAGGGAACGCGCATCATCGGCCAATATGATGACGGCGTGACCTTCGGCCAGCGCCGCGTCCT
GCTGGTGTGGAATCGCCTGATCCTGCCGGGCGGCCGCTCCATCGTTCTGGAGCGCCTGCCGGGCGCGGAC
GCTTCCGGTTACGCCGGGCTTGAGGATGGCGTCGATTATCACTGGTGGGATCTGATGAAAGCGGCAGGGC
TTTCCACACTGCTCGCGGTCGGTACAGAGCTGGCGACCAGCGACGAGGACCGGTTGATCCGCGCCATTCG
CGACGGCGCACAGGATACCGTCAATCAGGCCGGGCAGCAGATCGTCCAGCGCCAATTGCAGGTCGCGCCG
ACGCTCACCATCCGGCCCGGCTTTCCGGTCAGGATTATTGTGACCCGCGACCTGGTATTCGAGCCCGCAG
GAGGTTGA
 Primer design