SecReT4
Protein ID: 153011857
T4SS name [ID]VirB [777]
Gene symbol-
Locus tagOant_4554
StrainOchrobactrum anthropi ATCC 49188
Repliconplasmid pOANT01 [GenBank: NC_009669] [Browse all T4SS(s) in this replicon]
Location [Strand]89237..91324 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDA6X7N7
KEGG IDoan:Oant_4554
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.2e-90, Aligned region: 106..535
TraG-D_C [PF12696], Evalue: 7e-30, Aligned region: 382..504
TrwB_AAD_bind [PF10412], Evalue: 1.9e-28, Aligned region: 127..518
AAA_10 [PF12846], Evalue: 3.3e-05, Aligned region: 131..458
Protein Sequence: 695 a.a.     [Download]
>gi|153011857|ref|YP_001373070.1| TRAG family protein [Ochrobactrum anthropi ATCC 49188]
MSKGYKAVYLIFCAGIAFLVWTLAYGVVLGVIYKDSRILNITITENPFAPLQQVWAYASNSTLQRVAIGA
LLPAIAAAVFAGYLGLRSYENPLGDAAFQDVMGLRRGKWFRKKGHIFGRFGRNVLRAADSRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVSDLKGEIFKATAGYRKKNGSQVFLFAPGSETTNRYNPLDFVRPERGNRT
TDIQNIASILVPENLGSENSVWQGLAQQVVAGIISYVLESPYYHGRRNLGEVVSFVNSGVDLQAQIKFIK
EKEPNLSKYTVESFNAFLALSERAAASALLDIQNALRPFRNERIVAATEVTDMDIAAMKRRPISIYLAPN
ITDITILRPLLTLFVQQVMNILTLEHDPNSLPVYFLLDEFRQLKKMDEIMTKLPYVAGYNIKLAIIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYKSESRTIEILGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLVEGQRPIYGDKLRFFNTQPFKSAEAYSQSHVPDVPTIEYLPHRPVPALTS
EYASDGQQAIEHTITPLPSRPQKHEEPPHEAGANNSPSIPNADDSKKTNSRTVNLSVKLPSTGSETKSAI
PPADIHDRIEEVEAQLKPSAERLLKAVNEKVEASGASPRKRKSYLDIFNATVPDPEDIGLMTNSN
 
Nucleotide Sequence: 2088 bp     [Download]
>gi|153011772|ref|NC_009669.1|:c91324-89237 Ochrobactrum anthropi ATCC 49188 plasmid pOANT01, complete sequence
ATGAGCAAGGGATACAAAGCGGTTTATCTAATATTCTGTGCTGGCATCGCATTCTTGGTCTGGACCTTGG
CTTATGGAGTCGTACTCGGAGTCATTTATAAAGACAGCCGAATTTTGAATATTACCATCACCGAGAATCC
TTTTGCTCCGCTTCAGCAAGTCTGGGCCTATGCGTCCAACTCAACACTGCAGCGCGTTGCCATCGGGGCC
CTATTGCCTGCCATCGCAGCCGCGGTCTTTGCGGGCTATCTTGGTCTCAGAAGCTACGAAAACCCCTTGG
GCGATGCAGCTTTTCAGGACGTCATGGGCCTTCGTCGCGGCAAGTGGTTCCGCAAGAAAGGGCATATATT
CGGTCGGTTCGGCCGAAATGTGCTGCGAGCGGCCGACAGTCGCCATCATCTGATTATCGGCCCTACACGA
TCGGGAAAAGGAGCGGGTTATGTCATTCCAAACGCTCTCATGCATGAAGGGTCAATGATCGTATCCGACT
TGAAGGGCGAAATTTTCAAAGCGACAGCAGGGTATCGCAAGAAGAACGGTAGCCAGGTTTTCCTCTTTGC
CCCCGGCTCTGAAACGACAAATCGATATAACCCTCTCGATTTTGTGCGCCCCGAGCGGGGTAATCGCACC
ACGGATATACAAAATATCGCCAGCATTCTCGTCCCTGAGAATCTAGGCTCTGAAAATTCAGTCTGGCAGG
GCTTGGCACAACAAGTCGTAGCCGGGATTATCAGCTATGTTCTGGAGAGCCCCTATTATCACGGACGGCG
CAACCTCGGCGAAGTCGTTTCCTTCGTGAACAGTGGTGTTGATCTTCAGGCGCAGATCAAGTTCATCAAG
GAAAAAGAGCCGAACCTTTCAAAATATACGGTCGAAAGCTTTAACGCATTTCTTGCATTGTCAGAGCGGG
CGGCGGCATCCGCGCTACTGGATATCCAGAACGCGCTTAGACCCTTCCGAAATGAACGTATTGTAGCCGC
GACAGAAGTGACCGACATGGATATCGCCGCCATGAAACGGCGGCCTATCTCCATTTATCTCGCACCCAAT
ATTACCGATATTACGATCCTGCGCCCACTTCTCACTTTGTTCGTGCAGCAGGTCATGAACATTCTGACTC
TGGAACACGATCCCAATTCTCTTCCCGTCTATTTTTTGCTGGATGAATTTCGACAGCTTAAAAAGATGGA
TGAGATTATGACGAAGCTTCCCTATGTGGCTGGTTATAATATCAAGCTAGCTATCATTATTCAGGATCTC
AAGAATCTCGACGAGATTTATGGCGAGACTTCCCGTCACTCCCTTCTCGGCAACTGTGGTTATCAGCTGG
TGCTAGGTGCCAATGATCAGGCCACGGCGGAATATGCATCCCGTGCACTCGGAAAAAGAACCATCCGTTA
CAAGTCGGAATCCCGCACCATCGAGATTCTCGGTTTACCTCGGCGCACAAAAGTTGAGCAAATCCGAGAA
CGCGATTTGATGATGCCGCAAGAAGTGCGGCAAATGCCAGAAAACAAGATGATCTTGCTCGTTGAAGGAC
AACGACCGATCTATGGCGACAAGCTGCGATTTTTCAACACCCAACCCTTTAAATCCGCTGAAGCTTATTC
GCAATCGCACGTTCCTGATGTGCCTACGATTGAATATCTACCTCATAGGCCAGTTCCAGCACTGACGAGC
GAATACGCGAGTGACGGGCAACAGGCCATTGAGCACACAATTACGCCCCTGCCCTCTCGTCCTCAAAAGC
ATGAGGAACCTCCACATGAAGCGGGCGCAAACAATTCTCCGTCAATTCCTAACGCTGATGACAGCAAAAA
AACAAATAGCAGAACGGTCAATCTGAGCGTCAAATTACCTTCAACAGGCAGTGAAACGAAGTCGGCAATT
CCTCCCGCTGATATCCATGATCGAATTGAAGAAGTCGAAGCGCAGCTTAAACCGAGCGCAGAACGATTAT
TGAAGGCTGTGAATGAAAAAGTCGAAGCCTCGGGGGCATCCCCTCGAAAGCGAAAAAGTTATCTGGACAT
ATTCAATGCTACTGTGCCAGACCCGGAAGATATCGGCCTGATGACCAATTCTAACTAA
 Primer design