SecReT4
Protein ID: 153011858
T4SS name [ID]VirB [777]
Gene symbol-
Locus tagOant_4555
StrainOchrobactrum anthropi ATCC 49188
Repliconplasmid pOANT01 [GenBank: NC_009669] [Browse all T4SS(s) in this replicon]
Location [Strand]91321..92352 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDA6X7N8
KEGG IDoan:Oant_4555
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-83, Aligned region: 23..326
Protein Sequence: 343 a.a.     [Download]
>gi|153011858|ref|YP_001373071.1| P-type DNA transfer ATPase VirB11 [Ochrobactrum anthropi ATCC 49188]
MNAGANSAAAATQSRYYFLDRALEPLRPFLNDPKVVEIAVNKPGHVYIERLGADHMEFHEVHALSSAEIQ
NIGERVAGATDQFISKSAPILSAALPTGERIQVVLPPAAPDGGSISIRKQVVSNFSLEEYRDSGSLDKVS
VAVGGLSDIDRLLIEHLKQNRIFDFINTAITQRVSILISGGTSSGKTTFLNACLKSVHPKERIITLEDTR
ELLPPQENRVHLVASKGGQGTADVTIQHLLESSLRMRPDRLFVGEIRGAEAFSFLRAINTGHPGSMSTVH
ADTPQGAYEQLAMMMQQAGLSGGYSKHDLMSYIRMVIPIVIQLRRDGGKRGVSEIFFARNEEP
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|153011772|ref|NC_009669.1|:c92352-91321 Ochrobactrum anthropi ATCC 49188 plasmid pOANT01, complete sequence
GTGAACGCAGGGGCAAATAGTGCGGCAGCAGCCACACAAAGCAGATATTACTTTTTAGATCGAGCACTTG
AGCCGCTGCGGCCATTTCTCAACGATCCAAAAGTCGTGGAAATAGCTGTCAACAAACCAGGTCACGTCTA
TATCGAGCGACTTGGTGCCGATCACATGGAGTTCCACGAGGTTCATGCGCTTTCATCGGCGGAGATTCAG
AATATCGGTGAGCGCGTTGCGGGTGCGACTGATCAGTTTATCAGTAAATCCGCGCCAATCCTGAGCGCAG
CGCTTCCGACTGGCGAGCGCATTCAGGTGGTTCTTCCACCTGCTGCACCGGATGGCGGCTCGATATCGAT
CCGCAAGCAGGTCGTTAGCAATTTCAGCTTGGAAGAATACAGGGATAGCGGTTCGCTGGACAAGGTTTCC
GTGGCTGTTGGTGGGCTTAGTGATATTGACCGACTGCTGATCGAGCATCTGAAGCAAAACAGAATTTTCG
ATTTCATCAACACGGCCATTACGCAACGGGTTTCGATCCTGATTAGCGGCGGTACATCATCGGGAAAGAC
TACCTTTCTGAATGCCTGCCTGAAATCTGTCCATCCAAAGGAACGAATTATCACGCTGGAAGACACCCGC
GAGCTGTTACCGCCCCAGGAGAACCGCGTTCATCTGGTAGCCTCGAAAGGCGGACAGGGCACGGCTGACG
TTACAATTCAGCACTTGCTTGAATCGTCCCTTCGTATGCGTCCTGACCGTCTGTTCGTTGGTGAGATCCG
CGGAGCTGAAGCGTTTTCATTTCTTCGTGCCATTAACACCGGTCATCCAGGTTCTATGTCGACTGTTCAT
GCTGATACTCCGCAAGGAGCCTATGAACAGCTTGCCATGATGATGCAACAAGCCGGGCTTTCAGGCGGAT
ATTCGAAGCATGACCTCATGTCGTACATTCGAATGGTCATCCCCATTGTCATCCAGTTGCGCCGAGACGG
CGGAAAACGAGGCGTATCGGAGATATTTTTTGCGCGAAACGAGGAGCCATGA
 Primer design