SecReT4
Protein ID: 153011861
T4SS name [ID]VirB [777]
Gene symbol-
Locus tagOant_4558
StrainOchrobactrum anthropi ATCC 49188
Repliconplasmid pOANT01 [GenBank: NC_009669] [Browse all T4SS(s) in this replicon]
Location [Strand]94371..95066 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA6X7P1
KEGG IDoan:Oant_4558
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-63, Aligned region: 17..223
Protein Sequence: 231 a.a.     [Download]
>gi|153011861|ref|YP_001373074.1| VirB8 family protein [Ochrobactrum anthropi ATCC 49188]
MTDSKEAALRTYFQDGDRWENEIVRKAKRSKAVAWFVTIIFGLVALFALLALVMLVPLKSFEPVIVVVDK
ATGYIETKSGLTKAQNLTDSRAITQANVVRYIRTREGYDPYAIDTNFGTAALLSTGDAARELQEQYSAAN
PNNPAKVYGKNKRVLVDVKSVTFPNDSTALVRFSTTEKSDTDAITRHYIAVVRYRYTDEPATNEWRFENP
LGFQVYNYRRDQETVTEGSKG
 
Nucleotide Sequence: 696 bp     [Download]
>gi|153011772|ref|NC_009669.1|:c95066-94371 Ochrobactrum anthropi ATCC 49188 plasmid pOANT01, complete sequence
ATGACTGATTCCAAAGAAGCTGCATTGAGAACTTATTTTCAGGACGGTGATCGTTGGGAGAACGAAATCG
TCCGGAAAGCAAAACGTTCAAAAGCCGTGGCATGGTTCGTAACCATCATATTCGGGCTCGTCGCTCTTTT
CGCATTGCTCGCGCTCGTTATGCTGGTTCCGCTAAAATCTTTCGAGCCTGTGATTGTCGTCGTAGACAAG
GCTACCGGCTACATCGAAACCAAAAGCGGACTGACAAAAGCGCAAAATCTGACCGATTCACGCGCAATCA
CGCAAGCCAACGTCGTTCGGTATATCAGGACGCGCGAAGGCTATGATCCTTACGCGATCGATACAAATTT
TGGCACGGCGGCACTATTGTCGACAGGAGATGCCGCTCGCGAATTGCAAGAGCAATATAGCGCCGCGAAT
CCGAACAATCCGGCGAAGGTCTACGGGAAAAACAAGCGTGTGCTTGTCGATGTGAAGTCTGTCACCTTCC
CCAACGATTCAACCGCTCTTGTTCGTTTCTCAACCACTGAAAAGTCCGATACCGATGCCATTACCAGACA
CTACATAGCTGTCGTGCGCTATCGCTACACGGACGAACCCGCCACAAACGAATGGCGGTTTGAAAATCCC
CTCGGCTTCCAGGTTTATAATTACAGGCGTGATCAGGAAACCGTCACGGAAGGGAGCAAGGGATGA
 Primer design