SecReT4
Protein ID: 153930568
T4SS name [ID]Trb [60]
Gene symbol-
Locus tagYpsIP31758_A0052
StrainYersinia pseudotuberculosis IP 31758
Repliconplasmid plasmid_59kb [GenBank: NC_009704] [Browse all T4SS(s) in this replicon]
Location [Strand]11094..11981 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA7FC38
KEGG IDypi:YpsIP31758_A0052
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.6e-61, Aligned region: 70..293
Protein Sequence: 295 a.a.     [Download]
>gi|153930568|ref|YP_001393247.1| conjugal transfer protein TrbG [Yersinia pseudotuberculosis IP 31758]
MKKTIISILALSVLATPSYSVLADDLADQYFSKETRQLTPQEKAAIAIGEKWQTGNATSKPVAATDGSIR
FIFGSGQIQILCAVLQVCDIALQPGEQVNSINAGDPRFIVEPAITGSGASEQLHLIVKPLDVGLDTSLVV
GTDRRTYHFRLRSSRKEFMPLVSFTYPEDAQAKWAAIQAREKKEKTDNTIPQTGEYLGNLNFNYDISGSA
RWKPTRVYNDGTKTIIEMSSEMRQSEAPTLLVVRKNGGVFSDPETVMVNYRVQGNRYIVDTIFDKAMLVV
GVGSSQDRVTITRGK
 
Nucleotide Sequence: 888 bp     [Download]
>gi|153930562|ref|NC_009704.1|:11094-11981 Yersinia pseudotuberculosis IP 31758 plasmid_59kb, complete sequence
ATGAAAAAAACAATTATCTCTATATTAGCCCTTAGTGTTTTGGCTACACCCTCATATTCTGTTCTTGCTG
ATGATTTAGCCGACCAATATTTTTCAAAAGAAACTCGGCAATTAACACCTCAAGAAAAAGCCGCGATTGC
TATTGGTGAAAAATGGCAAACAGGCAATGCTACCAGCAAACCTGTAGCGGCGACTGATGGATCTATTCGG
TTTATTTTTGGTTCCGGACAAATTCAGATTTTATGCGCTGTTCTTCAAGTTTGTGATATTGCATTACAAC
CAGGAGAGCAAGTCAACAGCATTAATGCTGGCGACCCACGCTTTATTGTTGAACCTGCTATTACTGGATC
TGGTGCTTCTGAACAATTACATCTGATTGTGAAGCCATTAGATGTTGGCCTAGACACATCGCTTGTCGTC
GGAACAGATCGCAGAACATATCATTTTCGTCTTCGTTCTTCCCGCAAAGAGTTTATGCCGTTAGTTTCAT
TCACCTACCCCGAAGATGCTCAAGCTAAATGGGCAGCAATTCAGGCGAGAGAGAAGAAAGAGAAGACTGA
TAATACCATTCCACAAACTGGTGAATATCTTGGGAACTTAAACTTCAATTACGATATTTCCGGATCAGCT
CGTTGGAAGCCAACCCGAGTATATAACGATGGTACAAAAACCATTATTGAAATGTCGTCTGAAATGCGTC
AGTCCGAAGCACCAACTCTATTAGTTGTTAGAAAAAATGGAGGGGTGTTCAGTGACCCTGAAACGGTAAT
GGTTAACTATCGAGTACAAGGAAATCGTTACATAGTAGACACGATTTTTGACAAGGCAATGCTCGTTGTC
GGTGTCGGCTCAAGTCAAGACCGCGTAACAATTACCCGAGGGAAATAA
 Primer design