SecReT4
Protein ID: 153930587
T4SS name [ID]Trb [60]
Gene symbol-
Locus tagYpsIP31758_A0048
StrainYersinia pseudotuberculosis IP 31758
Repliconplasmid plasmid_59kb [GenBank: NC_009704] [Browse all T4SS(s) in this replicon]
Location [Strand]7133..7513 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA7FC34
KEGG IDypi:YpsIP31758_A0048
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.7e-18, Aligned region: 9..106
Protein Sequence: 126 a.a.     [Download]
>gi|153930587|ref|YP_001393243.1| conjugal transfer protein TrbC [Yersinia pseudotuberculosis IP 31758]
MQMTMPSINISNKTMLLLGIALLLMLSTHPALASNTSGGGLPFDEWFTKIRQSVTGPFAFTAAIVGLVAT
GATLIFGGDMNGFMKTLIFIVLVMSFLVAAQNTLAAITGQGAQIAMTFKFMEAGSI
 
Nucleotide Sequence: 381 bp     [Download]
>gi|153930562|ref|NC_009704.1|:7133-7513 Yersinia pseudotuberculosis IP 31758 plasmid_59kb, complete sequence
ATGCAGATGACCATGCCGAGTATCAACATTAGTAACAAAACAATGCTTTTGTTAGGCATTGCTTTGCTGC
TGATGTTATCTACACATCCGGCATTAGCATCGAATACGAGTGGAGGAGGGCTACCATTTGATGAATGGTT
CACCAAAATTCGTCAGTCTGTAACCGGCCCGTTCGCATTTACAGCTGCAATAGTTGGATTAGTAGCAACC
GGTGCCACCCTCATTTTTGGAGGGGATATGAATGGCTTTATGAAAACTTTGATTTTTATTGTTCTTGTAA
TGTCCTTCTTAGTAGCCGCTCAAAATACACTGGCGGCAATCACAGGCCAAGGTGCCCAAATCGCTATGAC
ATTTAAATTCATGGAAGCGGGGTCTATATAA
 Primer design