SecReT4
Protein ID: 153930596
T4SS name [ID]Trb [60]
Gene symbol-
Locus tagYpsIP31758_A0056
StrainYersinia pseudotuberculosis IP 31758
Repliconplasmid plasmid_59kb [GenBank: NC_009704] [Browse all T4SS(s) in this replicon]
Location [Strand]14774..16195 [+]
Productconjugal transfer protein TrbL/VirB6
Component typeTrbL
UniProt IDA7FC42
KEGG IDypi:YpsIP31758_A0056
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.2e-31, Aligned region: 83..295
Protein Sequence: 473 a.a.     [Download]
>gi|153930596|ref|YP_001393251.1| conjugal transfer protein TrbL/VirB6 [Yersinia pseudotuberculosis IP 31758]
MTVLELVISKKVLRKSGNTMKKISLSVLAVVLLIVALQAQAGTGINSAGLLDDILERFANTASGWGDRIV
SYGLWLFWGLTLLSMVWTYGMMVLKKSDIQEFFAETIRFLAATGFFLWILVNGPAIAISIINTCRQIAAN
ASGLSNALSPSGIVDIGFDIAGKVVDKSSIWSPADSTVGLLVATVILCMLALVAINMLLMLITGWLLAYA
GVFILGFGGGHWTQDIAIAYYKQVLGVGIQTFVMILLVGIGQSFIDQYYAAMGDDMALKELLVMLVASFV
LLMLVAQLPPMFAGIVGAGSGGGSLAFGMGAALGAAGMAAATAGAAGAAAISGATSAAGGMSALQAAFES
AQQSMDAGSSPSGEGRSSSGGSLSEAMGRAGGFARSMGSSLVDAARDVAQEKAGAIKDSIQERVSETTGG
KMADSIRESSGMNIGNDNSQFDGDGLGAGNNAGNSASTPETDEEMIDQFVNKK
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|153930562|ref|NC_009704.1|:14774-16195 Yersinia pseudotuberculosis IP 31758 plasmid_59kb, complete sequence
GTGACTGTTTTAGAACTGGTAATTTCGAAAAAAGTCCTGAGAAAAAGTGGTAACACCATGAAAAAAATCT
CTCTGTCCGTATTAGCTGTAGTGCTCCTGATTGTGGCTCTTCAGGCGCAAGCTGGCACCGGCATTAATAG
TGCTGGCTTACTTGATGACATATTAGAACGTTTCGCTAATACGGCCTCCGGATGGGGAGATCGCATAGTT
AGCTATGGTCTGTGGCTATTTTGGGGACTAACCCTTCTTAGCATGGTATGGACTTACGGCATGATGGTAT
TAAAGAAATCGGATATTCAAGAGTTCTTTGCGGAAACAATACGTTTTCTAGCCGCCACCGGTTTCTTTTT
ATGGATATTAGTTAATGGCCCAGCCATTGCTATTTCAATAATTAATACCTGCCGCCAAATAGCGGCTAAC
GCTTCTGGTTTAAGTAATGCTTTATCACCGTCAGGCATTGTAGATATTGGTTTCGATATTGCCGGAAAAG
TGGTTGATAAATCATCTATATGGTCACCGGCTGACTCCACTGTTGGACTGTTGGTTGCAACCGTTATTTT
ATGCATGTTGGCCCTAGTCGCAATCAACATGCTCTTAATGCTAATTACCGGCTGGCTCTTAGCTTACGCT
GGCGTTTTTATTCTTGGATTCGGCGGTGGCCATTGGACTCAAGATATTGCCATAGCGTATTACAAGCAAG
TACTCGGGGTAGGTATACAGACTTTCGTCATGATCCTCTTAGTCGGTATTGGGCAATCATTTATTGACCA
GTATTACGCGGCGATGGGTGATGACATGGCCCTTAAAGAACTGTTGGTTATGCTCGTTGCTTCCTTCGTT
CTATTAATGTTAGTTGCTCAACTACCACCAATGTTTGCGGGAATTGTCGGAGCCGGTTCTGGAGGCGGTT
CATTGGCGTTCGGTATGGGGGCGGCCCTTGGAGCAGCAGGTATGGCCGCAGCTACAGCAGGTGCCGCTGG
TGCCGCCGCAATCAGTGGAGCAACAAGCGCCGCAGGTGGAATGTCAGCGCTTCAGGCAGCATTTGAATCA
GCGCAGCAAAGCATGGACGCTGGCAGTAGCCCTAGTGGTGAAGGACGTAGCTCTTCAGGTGGAAGTCTTT
CAGAAGCAATGGGAAGGGCGGGGGGTTTTGCTAGGTCGATGGGATCAAGTCTTGTCGATGCTGCCCGTGA
TGTTGCTCAAGAAAAAGCTGGAGCAATAAAAGACTCAATTCAGGAAAGAGTCTCTGAAACCACTGGTGGA
AAAATGGCTGACTCGATCCGTGAAAGTAGTGGAATGAATATTGGAAATGATAACAGTCAATTTGATGGTG
ATGGTCTAGGGGCTGGAAACAATGCAGGAAATAGCGCTTCCACACCAGAAACCGATGAAGAAATGATTGA
TCAATTTGTTAATAAAAAATGA
 Primer design