SecReT4
Protein ID: 153946967
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3721
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4198803..4199621 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDA7FN47
KEGG IDypi:YpsIP31758_3721
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 272 a.a.     [Download]
>gi|153946967|ref|YP_001402675.1| hypothetical protein YpsIP31758_3721 [Yersinia pseudotuberculosis IP 31758]
MSPATLLDNAPVADPIGLNRSPRFTLQKAQLLKRLPYTVAALVLVVGSNSAHANLASNVTDYSSALETLQ
EKSVQLQSRQNPRQWGLSDVEWQKYLQLQQGKRGVQSPGLDPLTMLGVESETSAERRRLAELWVKEEYQR
TEKELAFQREVNAAWNRLYSGVLLVNMGSTSGIVPDSRGRLALFVRDNCARCDVRLAALLTDNRAVDIYL
VGSDGKDGSVRQWAVSRNIPVDRVRAGQVTLNHDRGLWRQYGQGQMPVILRKGENGWLIAAF
 
Nucleotide Sequence: 819 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4199621-4198803 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGTCGCCCGCAACCTTGCTGGATAATGCCCCAGTCGCTGATCCTATCGGTTTGAATCGCTCCCCACGCT
TTACGCTTCAAAAAGCGCAATTACTGAAACGCCTCCCTTACACCGTTGCAGCACTGGTTTTAGTCGTCGG
TTCGAATTCTGCCCACGCGAATTTGGCAAGTAATGTCACGGATTACAGTTCAGCACTTGAAACGTTGCAG
GAAAAATCAGTACAGCTTCAGTCCAGACAGAATCCCCGGCAGTGGGGGCTAAGTGATGTTGAATGGCAAA
AATATCTGCAATTACAGCAAGGTAAGCGTGGCGTACAGTCACCGGGGCTGGATCCTCTGACGATGCTTGG
TGTGGAAAGTGAAACGTCAGCAGAGCGTCGTCGTTTGGCTGAACTTTGGGTGAAAGAAGAATATCAGCGG
ACAGAGAAAGAACTGGCATTTCAACGTGAGGTCAACGCCGCCTGGAATCGCCTCTATTCGGGTGTGTTGT
TGGTAAATATGGGGAGTACGAGCGGTATCGTACCCGATAGCCGTGGTCGGCTGGCGCTGTTTGTCCGTGA
TAACTGCGCTCGTTGTGACGTCAGGCTGGCTGCGCTTCTCACCGATAATCGCGCCGTTGATATTTACCTG
GTAGGCAGCGACGGAAAAGATGGCTCAGTACGTCAATGGGCTGTCAGCCGAAATATTCCAGTGGATAGAG
TGAGGGCCGGACAGGTCACTCTAAATCACGATCGCGGTTTATGGCGACAATACGGTCAAGGCCAAATGCC
CGTTATTCTGCGAAAAGGGGAGAATGGATGGCTAATCGCAGCATTCTGA
 Primer design