SecReT4
Protein ID: 153947175
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3705
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4182460..4185306 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDA7FN31
KEGG IDypi:YpsIP31758_3705
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.2e-64, Aligned region: 48..314
AAA_10 [PF12846], Evalue: 3.5e-47, Aligned region: 507..849
Protein Sequence: 948 a.a.     [Download]
>gi|153947175|ref|YP_001402659.1| hypothetical protein YpsIP31758_3705 [Yersinia pseudotuberculosis IP 31758]
MFSLFRPKAASPDIHLNDDGPFAVAGREPCSREGKFTHSDEAKSYGTEPSIIDYMPWGEYLREERCLLLD
DGLSVGAVFEVIPVGTEGRSTERLEEIRDVVEDALQDSLPELNDHQWVVQFYCQDETDVTAYMDKLRSYV
KPWAQGTPFTQAWLAETENHMKSISVEKGLFEDKVVTGAPWRGQTRRTRMVIYRYVEKRGHELRSPAVML
NQVCDRLTSALAGAGIRCERQNGEQIHSWLLRWFNPKPEWVAPNVLYRTARYDDGAPDSLPILNDFSETL
WFTRPRSDAERGVWWFDNMAHKAVPVERLRRAPQTGHLTGEVKRGENINTLMDLMPEGTMIAMTLIVQPQ
DVLEEEFNRLGRNAMGENIESTRVREDEHSAREYLGERHKLYRATLTFLIKASDLDILDKRYLDISAKLL
NAGLQPVNPEHDVAPLNGYLRALPMCFNPDADKNHWYTRLTFVQHFACLLPVFGRDTGTGHPGFSFFNRG
GAPLTFDPLNKDDRTQNAHLLLFGPTGSGKSATLCSSLSQLMAVHRPRLFLLEAGNSFGLFADYCSSLGL
TVNKISVKPGKGVSLAPFADAHLLLQASPDEWVTDEAELSDIDTTDDNDDKRDILGEMEIAARLMVTGGE
AAEEARMTRADRGMLREAILAAARTSFEAGRQMLPEDLMRELENIARDNHTDENGRERRTAGRRARAEEM
SQALRMFTGGFEGELFNRPGAPWPEADVTLIDLGTLAREGYEAQMAVAVIALVNTVNNIAERDQYLDREI
NMVIDEAHIVTTNPLLSPYMTKVVKMWRKLGAWLWLATQNLADYPDTAEKMLNMAEWWLCLTMPPDEVEQ
ISRFKKLTEEQKTMLLSATKLPRCYTEGVVLAKRVEALFRAVPPSLYLALGMTEKEEKAERRQLMTEHNC
SELEAAFHVARKLDRARGMTAKEKSPKTGVDCSNPLGR
 
Nucleotide Sequence: 2847 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4185306-4182460 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGTTTTCATTATTTCGCCCTAAAGCGGCCTCACCCGATATTCATTTGAACGATGATGGCCCTTTTGCTG
TTGCGGGACGTGAACCGTGCAGTCGGGAAGGGAAGTTTACCCATAGCGATGAAGCAAAATCGTATGGCAC
CGAACCGTCGATTATTGATTATATGCCTTGGGGGGAATATCTCCGGGAAGAGCGTTGTTTGTTACTGGAT
GATGGCTTGTCGGTCGGCGCAGTTTTTGAAGTGATCCCGGTCGGAACGGAAGGGCGCTCAACTGAACGGC
TTGAGGAGATCCGAGACGTTGTGGAAGATGCATTGCAGGACAGTTTACCTGAGCTGAATGACCACCAATG
GGTGGTGCAGTTTTATTGTCAGGATGAGACGGATGTCACGGCGTACATGGATAAGCTGCGTAGCTATGTG
AAACCTTGGGCACAGGGCACGCCGTTTACACAGGCCTGGCTGGCCGAAACAGAAAACCACATGAAAAGCA
TCTCAGTGGAAAAAGGCCTGTTTGAGGATAAGGTTGTCACGGGTGCGCCATGGCGCGGTCAGACGCGCCG
CACGCGGATGGTGATTTACCGCTATGTTGAAAAACGTGGGCATGAACTGCGGTCACCAGCAGTAATGCTA
AATCAAGTTTGTGATCGCCTGACCTCTGCGTTAGCCGGTGCAGGTATCCGCTGTGAGCGACAAAATGGGG
AGCAAATTCATAGCTGGTTGTTGCGCTGGTTTAATCCTAAACCTGAATGGGTTGCACCGAATGTACTTTA
CCGTACTGCCCGGTACGATGACGGCGCGCCGGACTCTTTGCCGATTCTGAATGATTTCAGCGAAACCCTG
TGGTTTACCCGCCCACGTAGTGACGCTGAACGCGGCGTATGGTGGTTTGATAACATGGCGCATAAAGCGG
TGCCGGTAGAGCGACTGCGCCGTGCTCCTCAGACGGGGCATCTGACTGGCGAAGTCAAGCGCGGTGAAAA
TATCAATACATTGATGGATCTGATGCCGGAAGGCACCATGATTGCCATGACGTTAATTGTGCAACCGCAA
GATGTGCTGGAAGAGGAGTTTAACCGCCTTGGCCGCAACGCGATGGGGGAAAATATTGAATCGACTCGCG
TCCGTGAAGATGAACATAGCGCCCGTGAATATCTGGGCGAACGGCATAAATTGTACCGAGCCACGCTGAC
GTTCCTGATCAAAGCATCGGATCTGGATATTCTGGACAAACGTTATCTCGATATTAGCGCCAAACTGCTT
AATGCCGGGTTACAGCCGGTCAATCCTGAGCACGACGTAGCGCCACTTAACGGCTATTTGCGGGCATTGC
CCATGTGTTTTAACCCCGATGCGGATAAAAATCATTGGTACACTCGGCTAACCTTCGTGCAGCATTTTGC
CTGCCTGCTGCCGGTATTTGGGCGGGACACCGGCACCGGTCATCCGGGGTTTTCGTTCTTCAATCGTGGC
GGTGCGCCGCTAACTTTTGATCCACTCAACAAAGACGACCGCACGCAGAATGCCCATTTGTTGTTGTTCG
GGCCAACCGGCTCAGGAAAATCAGCCACGCTGTGCAGTTCGTTGTCTCAACTGATGGCGGTTCACCGTCC
ACGTCTGTTTCTACTGGAAGCCGGTAACTCTTTTGGCCTGTTTGCCGACTATTGCAGCTCGTTGGGGCTG
ACGGTCAATAAAATTAGCGTTAAACCCGGTAAAGGGGTTTCATTGGCTCCGTTTGCCGATGCACATCTGC
TATTGCAGGCCTCTCCCGATGAATGGGTCACGGATGAAGCAGAATTATCCGATATTGATACAACCGACGA
CAACGATGATAAACGCGATATTCTCGGTGAAATGGAGATTGCCGCTCGCCTGATGGTTACCGGCGGTGAA
GCGGCTGAAGAGGCTCGCATGACGCGGGCTGATCGGGGGATGTTGCGCGAAGCCATTCTGGCCGCAGCAC
GTACTTCCTTTGAGGCGGGGCGTCAAATGTTGCCGGAGGATTTAATGCGTGAGCTGGAAAATATTGCTCG
TGACAACCATACAGATGAAAACGGACGTGAGCGCAGAACCGCCGGTCGGCGGGCCAGGGCAGAAGAGATG
TCGCAAGCGCTGCGAATGTTTACCGGAGGATTTGAAGGTGAGCTGTTCAACCGCCCTGGAGCGCCCTGGC
CAGAAGCCGATGTCACGCTTATTGACCTCGGCACCCTTGCTCGCGAAGGCTACGAAGCACAGATGGCGGT
CGCCGTTATCGCTCTGGTAAACACTGTCAATAACATCGCAGAACGTGATCAGTATCTCGATCGGGAAATC
AATATGGTCATTGATGAAGCTCATATTGTGACCACTAACCCGCTGTTATCGCCTTATATGACCAAGGTCG
TAAAAATGTGGCGCAAGCTCGGTGCCTGGTTGTGGCTGGCAACACAGAATTTGGCTGATTACCCTGATAC
CGCAGAAAAAATGCTGAACATGGCGGAGTGGTGGCTGTGTCTGACGATGCCACCAGATGAGGTCGAACAG
ATTTCCCGCTTCAAAAAACTCACCGAGGAGCAAAAAACCATGTTGTTATCGGCAACAAAACTCCCCAGAT
GCTACACGGAGGGTGTGGTGTTGGCCAAACGTGTCGAGGCTTTATTCAGGGCGGTACCGCCCAGCCTTTA
TTTAGCGCTGGGAATGACGGAGAAAGAAGAAAAAGCAGAGCGCCGTCAGTTAATGACTGAGCATAATTGC
AGTGAACTGGAAGCGGCATTCCATGTGGCGCGAAAGCTGGATAGGGCGCGGGGTATGACAGCAAAAGAAA
AGTCACCCAAAACGGGGGTTGACTGCTCAAATCCTTTGGGCAGATAA
 Primer design