SecReT4
Protein ID: 153947204
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3713
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4189742..4190050 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDA7FN39
KEGG IDypi:YpsIP31758_3713
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.9e-28, Aligned region: 19..97
Protein Sequence: 102 a.a.     [Download]
>gi|153947204|ref|YP_001402667.1| hypothetical protein YpsIP31758_3713 [Yersinia pseudotuberculosis IP 31758]
MRLFPKLSVLLLTTASTLPIQATEKDELALVMRQLDQVQASFDRARVVANQNGLDARFYFDYLSAINDIT
TMKQGIESYLAPSRAQPSLPMLVTGQYRKDNR
 
Nucleotide Sequence: 309 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4190050-4189742 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGCGCCTATTCCCCAAACTCAGCGTATTGCTACTGACGACGGCCAGCACGCTCCCAATTCAAGCGACCG
AAAAAGATGAACTGGCGTTGGTTATGCGCCAACTCGATCAGGTTCAGGCCAGTTTTGATCGCGCCCGCGT
AGTGGCTAATCAGAACGGCCTGGATGCCCGCTTTTATTTCGATTACCTCAGCGCCATAAACGACATCACC
ACCATGAAACAGGGGATTGAAAGCTATCTGGCCCCTTCGCGTGCCCAGCCATCACTGCCCATGTTGGTCA
CCGGTCAGTATCGCAAGGATAATCGTTGA
 Primer design