SecReT4
Protein ID: 153947339
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3708
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4187234..4188100 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDA7FN34
KEGG IDypi:YpsIP31758_3708
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 2.5e-112, Aligned region: 2..283
Protein Sequence: 288 a.a.     [Download]
>gi|153947339|ref|YP_001402662.1| hypothetical protein YpsIP31758_3708 [Yersinia pseudotuberculosis IP 31758]
MKPNVLVAAVFMVMPIVVSAVELMKWERIPLQIPLNVGQERIVFVDKNVRVGFPPTLNGKLRVQSSGGAV
YLSASEAFPVTRLQLQNKANGEIILLDVSAAPGKSIREPVQLVYDGEVSSASTSDKTRISGNEQTAVISE
RRKPAKLNTPLPVVLTRYAAQSLYGPLRTVEPVVSITNTALKLPSRLTTLYPSEPVEVSPLAGWSLNGYS
VIALLVRNTATVNVILNPRMLQGEFISAAFQHPWLGKAGTPEDTTVLYLVVRGRPEGAFRSEPMAVTDKT
HQTRGTPK
 
Nucleotide Sequence: 867 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4188100-4187234 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
GTGAAGCCGAACGTCTTGGTCGCCGCGGTATTCATGGTGATGCCCATTGTAGTCAGCGCTGTTGAATTGA
TGAAGTGGGAACGCATCCCCTTGCAGATACCGCTGAACGTAGGGCAGGAGCGTATTGTTTTCGTCGATAA
AAATGTGCGAGTGGGTTTTCCTCCTACTCTGAACGGTAAATTACGGGTGCAGAGCAGCGGAGGCGCTGTT
TACCTTAGCGCCAGCGAGGCTTTCCCAGTGACCCGCTTGCAACTACAAAACAAGGCAAACGGCGAGATTA
TTCTTCTTGATGTCAGCGCCGCGCCGGGTAAGTCAATTCGGGAGCCTGTTCAACTGGTCTATGACGGTGA
AGTATCTTCTGCTTCTACCAGTGATAAAACTCGGATTAGCGGTAACGAGCAAACAGCAGTGATATCCGAA
CGGCGTAAGCCAGCAAAGCTGAATACGCCGTTACCGGTGGTCTTGACGCGCTATGCCGCGCAAAGTTTAT
ATGGCCCATTGCGCACGGTTGAACCTGTTGTGAGCATCACCAACACGGCGCTCAAACTTCCTTCACGGCT
GACCACTCTGTATCCCTCGGAACCCGTCGAGGTGAGTCCTCTGGCGGGCTGGAGCCTCAATGGCTACAGC
GTTATCGCATTACTGGTGCGCAATACCGCCACGGTTAACGTCATTCTGAACCCTCGAATGTTGCAGGGAG
AATTCATTTCTGCCGCTTTCCAGCACCCTTGGTTAGGCAAGGCGGGAACGCCAGAAGACACAACCGTATT
GTATTTGGTTGTTCGAGGGCGTCCTGAGGGAGCATTTAGATCTGAACCCATGGCGGTAACGGACAAGACT
CACCAAACGCGGGGAACGCCTAAATGA
 Primer design