SecReT4
Protein ID: 153947855
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3709
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4188097..4188750 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDA7FN35
KEGG IDypi:YpsIP31758_3709
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.5e-91, Aligned region: 5..203
Protein Sequence: 217 a.a.     [Download]
>gi|153947855|ref|YP_001402663.1| hypothetical protein YpsIP31758_3709 [Yersinia pseudotuberculosis IP 31758]
MSRFRHAVSARDNHISSLRLFCIMFFIGMVASSIGWMRAPDELTIHNPPDLRSGSTKKWWEVPPSTVYSF
AFYIFQQLNAWPKNGEVDYPAKIIQLAPYLTPACQSFLHQDARFRTDNGELRDRVRVVYEIPKRGYSNKS
VDIKSDNEWRARLDLVADEYYHSEPVKRVMVRYPIKVIRWEGDPERNPFGLAIDCYDGVPQRLEAIQTQQ
KKTEVFQ
 
Nucleotide Sequence: 654 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4188750-4188097 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGAGCCGTTTTCGCCATGCTGTTAGCGCCCGAGATAATCATATTTCCTCGCTTCGTCTATTCTGCATCA
TGTTCTTTATTGGCATGGTGGCCAGCAGCATTGGCTGGATGCGTGCGCCAGACGAACTCACTATCCACAA
CCCGCCAGATTTGCGTTCCGGTAGTACCAAAAAATGGTGGGAAGTGCCGCCATCCACCGTTTACAGCTTT
GCGTTTTACATCTTCCAGCAACTGAATGCCTGGCCCAAGAATGGTGAGGTAGATTATCCAGCCAAAATTA
TCCAATTAGCACCCTATCTGACTCCTGCCTGTCAGAGTTTTTTACACCAAGATGCGCGTTTTCGCACGGA
TAACGGAGAACTTAGGGATCGCGTGCGGGTCGTTTATGAAATCCCCAAACGGGGTTACAGCAACAAAAGT
GTAGACATCAAATCTGATAACGAATGGAGAGCCAGACTGGATCTGGTGGCCGATGAATATTACCACTCCG
AGCCGGTTAAGCGCGTGATGGTGCGCTATCCCATCAAGGTGATCCGCTGGGAAGGAGACCCGGAACGTAA
CCCATTTGGTTTGGCGATTGATTGTTATGACGGCGTGCCGCAGCGCCTTGAGGCCATACAGACCCAACAA
AAGAAAACGGAGGTGTTCCAGTGA
 Primer design