SecReT4
Protein ID: 153947897
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3720
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4198186..4198824 [-]
Producttransglycosylase
Component typeTfc4
UniProt IDA7FN46
KEGG IDypi:YpsIP31758_3720
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 212 a.a.     [Download]
>gi|153947897|ref|YP_001402674.1| transglycosylase [Yersinia pseudotuberculosis IP 31758]
MANRSILTAIFLMLFILGNGLPASAKTHPTLQTIPSIYREIAAEARVPAAFLYSLALVESSRRFKGGERP
WPWTINVAGKGYRYETREEAWHALLRFVRQAPLKRIDVGIAQVNLGWNGHLFPSFYDVFDPNTNLRVAAQ
ILRACYENRAGSWINAAGCYHHPAGGKPAANYIAIVRRKLDTLAPVHIAVSSKTTISDVTSVNHPLIWIE
PK
 
Nucleotide Sequence: 639 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4198824-4198186 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCTAATCGCAGCATTCTGACCGCAATCTTCCTGATGTTGTTTATATTGGGCAACGGCTTGCCAGCAT
CAGCCAAAACTCATCCCACATTGCAGACAATCCCCTCGATCTATAGGGAAATCGCCGCTGAAGCCCGAGT
ACCAGCGGCGTTTCTATACTCGCTGGCGCTGGTTGAAAGTTCACGGCGCTTTAAGGGCGGAGAGCGTCCG
TGGCCATGGACGATTAATGTGGCAGGCAAAGGGTATCGCTATGAAACCCGGGAGGAGGCGTGGCACGCAC
TACTCAGATTCGTTCGCCAGGCACCACTGAAGCGTATTGACGTGGGCATTGCCCAAGTCAATTTGGGTTG
GAATGGCCATCTTTTCCCTTCTTTTTATGATGTTTTTGACCCTAACACCAATTTGCGTGTCGCTGCGCAG
ATCCTTCGTGCCTGCTATGAAAACCGCGCGGGTAGCTGGATAAACGCAGCGGGCTGCTATCACCATCCTG
CCGGTGGAAAACCCGCTGCTAATTATATCGCCATTGTGCGTCGCAAATTAGACACCCTGGCTCCAGTACA
CATTGCAGTATCAAGCAAGACGACCATCTCTGATGTTACATCGGTTAACCATCCACTCATCTGGATTGAG
CCAAAATGA
 Primer design