SecReT4
Protein ID: 153948305
T4SS name [ID]Tfc [685]
Gene symbol-
Locus tagYpsIP31758_3710
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T4SS(s) in this replicon]
Location [Strand]4188747..4189121 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDA7FN36
KEGG IDypi:YpsIP31758_3710
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.5e-38, Aligned region: 3..117
Protein Sequence: 124 a.a.     [Download]
>gi|153948305|ref|YP_001402664.1| hypothetical protein YpsIP31758_3710 [Yersinia pseudotuberculosis IP 31758]
MAVIEFLPDRLNAPPVIWRGFTSGEFLLAACCGCLLGIPVSIPFAFIPALGWIAIPTGMLIMPILVVFIG
GRWVSQYKRGKPDNYLWRRLEEVRVRLGWAQNLIIISRAWALRRSHPFQRGCAE
 
Nucleotide Sequence: 375 bp     [Download]
>gi|153946813|ref|NC_009708.1|:c4189121-4188747 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCCGTCATTGAGTTTCTTCCCGATCGCTTGAATGCGCCACCTGTTATTTGGCGTGGGTTCACTTCCG
GTGAATTCCTTCTGGCGGCTTGTTGTGGTTGTTTACTGGGTATCCCGGTCTCTATTCCATTCGCTTTCAT
CCCCGCACTGGGTTGGATAGCTATCCCAACAGGCATGTTGATTATGCCTATTCTGGTTGTTTTTATTGGT
GGCCGATGGGTCAGTCAATATAAGCGAGGCAAACCGGATAATTACCTCTGGCGGCGCTTGGAGGAGGTGC
GTGTGCGGCTTGGATGGGCACAAAACCTCATTATTATCAGCCGGGCATGGGCGCTGCGGCGTTCGCATCC
ATTCCAACGAGGGTGTGCCGAATGA
 Primer design